(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE242

CP000435.PE242       Location/Qualifiers
FT   CDS_pept        complement(253025..254215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0245"
FT                   /product="Uncharacterized conserved membrane-associated
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01933;
FT                   match to protein family HMM TIGR01826"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45181"
FT                   /db_xref="GOA:Q0IDJ1"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDJ1"
FT                   /protein_id="ABI45181.1"
FT                   /translation="MLWAIQESLGWITRVLPGAITGPLVLLLGVGLLLWGQSQSFGSIQ
FT                   QALAPEKDTVLVDALRAKSRLNRGPSIVAIGGGTGLSTLLSGLKRYSSHITAIVTVADD
FT                   GGSSGVLRRELGVLPPGDIRNCLAALSTEEPLLTRLFQYRFSAGSGLEGHSFGNLFLSA
FT                   LSAITGSLETAITASSRVLAVQGQVVPATNADVRLWAELEDGTRIEGESAIGNARSPIV
FT                   RMGCLPEKPPALPRALEAIAHADLILLGPGSLYTSLLPNLLVPELVTAIQRSRAPRLYI
FT                   CNLMTQPGETDGLDVSGHLRAIEAQLASLGVSKRLFDCVLAQEPIRESALLAHYRKLGA
FT                   EPVICNSSHLQQEGFEVMQAPLQGSRPTATLRHDPRSLALAVMRFYRRHKRDNQNA"
     atgctgtggg cgattcaaga atcccttgga tggatcacaa gagtgttgcc gggggcgatc        60
     accggccctc ttgttcttct gctgggagtc ggactgctgc tctgggggca aagccagagt       120
     tttggttcga tccaacaagc cctggccccg gaaaaagaca cggtcttagt ggatgcgttg       180
     cgtgcaaaaa gtcgcctcaa tcgagggccg agcatcgtgg cgattggtgg tggaacaggc       240
     ctatccacct tgctgagtgg gcttaagcgc tacagcagcc acatcaccgc aatcgtgacc       300
     gttgccgatg acggcggcag tagcggcgtg ctgcgccgcg aacttggtgt gttgcctcca       360
     ggtgacatcc gcaactgtct tgccgcgctc tctacagaag aacccttact cacccggctg       420
     ttccaatacc gcttctcggc tggcagcggt ctagaaggcc acagctttgg caatctcttt       480
     ctttccgccc tcagcgcgat tacggggagt ctggaaacag cgatcacagc ctcaagtcgc       540
     gttctcgcgg ttcaaggcca agtggtccct gccaccaacg ctgacgtccg tctctgggct       600
     gaactcgaag acggcaccag gattgaaggg gaatcggcga tcggcaatgc acgcagcccg       660
     attgtgcgga tgggatgcct gccggaaaag ccaccggcat tacccagagc actggaagcc       720
     attgcccacg ccgatttgat tttgctgggg ccaggcagtt tgtacacctc actcctcccc       780
     aacttgctag tgcctgaatt agtcacggcc attcaacgca gccgcgcgcc caggctttac       840
     atctgcaacc tgatgaccca accaggcgaa acggatggat tggatgtgag tggtcacctg       900
     cgagccatcg aagcccaatt ggcttctctc ggggtgagca agcgcttgtt cgactgcgtg       960
     ctcgcccagg agccaatcag ggaatctgct cttctggcgc actaccggaa attgggtgca      1020
     gaaccagtga tctgcaacag cagccacctg caacaagaag gctttgaagt catgcaagcc      1080
     ccacttcaag ggagtcggcc cacggcgact ctccgtcacg atccgcgcag tcttgcctta      1140
     gctgtgatgc gcttttaccg gcggcataag cgtgacaatc aaaacgcttg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page