(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE253

CP000435.PE253       Location/Qualifiers
FT   CDS_pept        complement(263394..263858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0256"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45890"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDI0"
FT                   /protein_id="ABI45890.1"
FT                   /translation="MPQHTPQYPAILMDPSKPILWVHEEALGPANPALQDYPNAPGLFV
FT                   FDDTWIEDQSISRKRIGFLYESALSLPLTLRRGDVAREVLGFAQRHGADAVVTSTVVDP
FT                   RLQRIAAAIDRELPLWMLDPDPFVELHKPPRLGRFSRYWREAEPVVWETF"
     atgccccagc acacgcccca gtacccagcg attttgatgg atcccagtaa accaatcctc        60
     tgggtgcatg aagaagccct gggaccagcc aacccggctc ttcaggacta ccccaacgca       120
     ccaggactat tcgtattcga cgacacctgg attgaagacc agtccatcag tcgcaaacgc       180
     atcggttttt tgtacgaatc cgctttgagc cttccgctca ccctgcgccg aggtgatgtg       240
     gcgcgtgagg tgctgggttt cgcccaacgc cacggagccg atgctgtggt caccagcacc       300
     gtggtggatc cccgcctgca acgcattgct gcggccattg atcgggagct tcccctctgg       360
     atgctcgacc cggatccctt tgtggagtta cacaaaccac cacggctggg tcgatttagt       420
     cgctactggc gagaagcgga acctgtggtc tgggagacct tttag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page