(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE255

CP000435.PE255       Location/Qualifiers
FT   CDS_pept        264880..265662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0258"
FT                   /product="enoyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.3.1.9"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47476"
FT                   /db_xref="GOA:Q0IDH8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH8"
FT                   /protein_id="ABI47476.1"
FT                   /translation="MLLDLTGKKILVTGIANNRSIAWGIAQQLKAAGAELGITYLPDEK
FT                   GRFESKVRELTAPLEPSLFLPLNVQDAAQMETVFAEIKDKWGQLDGLVHCLAFAGKEEL
FT                   VGDFSATTAEGFARALEISAYSLAPLCRHAKPLFSEKAGVVTLTYLGAERAIPNYNVMG
FT                   VAKAALEASVRYLSAELGPEKQVRVNAISAGPIRTLASSAIGGILDMIHNVEEKAPLRR
FT                   TVTQNEVGNTAAFLLSDLSSGISGQTIYVDAGYCINGM"
     atgcttcttg atctcactgg taagaagatc cttgttactg gcatcgccaa caatcgctcc        60
     attgcctggg gcatcgcgca acagctcaag gcggctggag ccgagctagg aatcacctac       120
     ctgcctgatg agaagggccg gtttgaatca aaggttcgtg agctcacggc tccgttagag       180
     ccttcgttgt ttttgcctct gaatgttcag gatgccgctc agatggagac ggtgttcgct       240
     gaaattaaag acaagtgggg gcagctggat ggcctcgtgc attgtttggc gtttgcggga       300
     aaagaagaat tagtgggcga cttcagcgcc accacggcgg aaggttttgc acgtgcctta       360
     gagatcagtg cctattccct tgcacctctg tgccgtcatg ccaagccgtt gttcagtgag       420
     aaagcgggtg tggtgacctt gacctacctc ggcgctgagc gggcgattcc taactacaac       480
     gtgatgggtg tggctaaggc ggctctggaa gcctccgttc gctatctctc tgctgagctt       540
     ggacccgaga aacaggtgcg cgtgaatgcg atcagtgctg gcccgatccg cacgctggcg       600
     agctctgcaa tcggaggcat cctcgacatg atccacaacg tggaggaaaa ggcgccgcta       660
     cgccgtacgg ttactcaaaa tgaagttggg aacacggctg cgttcctgct cagtgatttg       720
     tcgagtggca tttctggcca aaccatctac gtggacgctg gctactgcat caacggcatg       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page