(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE256

CP000435.PE256       Location/Qualifiers
FT   CDS_pept        265659..266558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47891"
FT                   /db_xref="GOA:Q0IDH7"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH7"
FT                   /protein_id="ABI47891.1"
FT                   /translation="MIRPRGCLDYLKLSWWLIVHQGKSLLLATLLCAISLPLNEIISTA
FT                   LLPEALVQVLGLLLSLFLGFRYSQAYNRWLEARVLWGALVNHSRSWRDLLVRVLPRQLP
FT                   LSWKRRLLQEVVLLVWCLNAQLRSSKGSAVLLPEPVRELGVKIGLRNLSVQSLLKRMAR
FT                   EQHLLRQGGWVDSFQSSEFGLLQQAFTNVIGGLERIRHQPLPASSTFFIRGMTWVYGYL
FT                   VFLKLDALGHISAALLGWLVFLIFLMAERIGTFIERPFVDARFALPMDHFCALISLDLL
FT                   GASSPLAKPSSTKGPWLR"
     gtgatcaggc cgcgcggatg tcttgattac ctgaaactct cctggtggtt gattgttcac        60
     caggggaaga gtttgctgct cgcaacgctg ctttgtgcga tcagtctccc tttaaacgag       120
     ataatttcta cggcgctgct cccagaagct cttgttcagg ttcttggtct gcttctcagc       180
     ctttttcttg gttttcgcta cagccaggca tacaaccgct ggctagaagc acgggtgttg       240
     tggggcgcgt tggtgaatca cagtcgcagt tggcgtgact tgttagtgcg tgttttaccc       300
     cgccagctgc cgctgtcctg gaaacgtcgc ctgcttcagg aggtggtgct tttggtgtgg       360
     tgcctgaatg ctcaactgcg cagctccaaa ggcagcgcgg tcttgctccc cgagcctgtg       420
     cgtgagctgg gggtgaagat tggactgcgc aacctcagtg tgcaatcgct gctgaagcga       480
     atggcacgag agcagcattt acttcgccag ggaggctggg tggatagttt ccaaagcagt       540
     gagtttggtc ttctgcagca ggcgttcacc aatgtgattg gcggtctgga acgcatccgt       600
     caccaacctc ttccagcgtc atcaaccttc tttattcgag gcatgacctg ggtctatggc       660
     tatttggttt ttctaaaact cgatgcgctg ggacacattt ctgcagcgct gctgggttgg       720
     ctggtgtttt tgatttttct catggctgag aggattggaa cttttattga gcgccctttt       780
     gttgatgccc gttttgcgtt gccgatggat cacttttgtg cgttgatcag cctcgatctt       840
     cttggggctt cctccccatt ggctaaacct tcttccacaa agggcccctg gctgcgctga       900
//

If you have problems or comments...

PBIL Back to PBIL home page