(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE259

CP000435.PE259       Location/Qualifiers
FT   CDS_pept        269019..271727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0262"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45999"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH4"
FT                   /protein_id="ABI45999.1"
FT                   /translation="MLFSILFKGKLGNVYNSFLYSFWGKKSSASPYDKTSLGDNRDEPE
FT                   FDLVSSIDEKAKLALTVFSGDIKIAPNGLELNNDIELQSTGLELNSDTEFKPTSLELSN
FT                   DIELQSNGLELSNDIELQSNGLELSNDIELQSNGLELSNDIELQSNGLELNSDIKLKSV
FT                   DFFPESQFVSDGNEINVTLESSTQISGINALPTTFKIQSETGTPRANSSLISFADSSSQ
FT                   NFSAKSLLAPWLDLIKEPVVNSGSFQDAFSSVGNFNSLIKNILQLNPSSLKIQPLENLA
FT                   GVFDTADHLLAWNTLALDFATASVSGPTPCSRFFGYLNISQWDSWAVFEDTAIGSIYNK
FT                   EKQASFISLLDSFEISSNDLAEFKCLYQASTKIVQEILEHAVRQVAMDVSAFNVVSGIE
FT                   TSLFKEGIPESLVGAAQKLLAKNLDLSELGKKIGDLVVSIGTNIGETVSSSINQYALGD
FT                   GSNQLGFYADTTDYIPSPSVYDPNDPNTKIDSSWQPLEGQSALTPQWGAVTPFAIEPDN
FT                   LIPSSSIVTPYTELGELNSDFIDELMNVRDKRLNLTAEEAAIAEYYEGGPFTSFPPGLW
FT                   QQQSVDLSISRNLDLDQALKLNLGVSLALSDAGIATWNLKYSANTVRPITAIRQYKPDT
FT                   VLSDGSLAGDWEPYLDTPPFPDIASGHSAFSSSANYIFNQSFESNYFDFSVTLADDDSV
FT                   YSVDGFDGIPGVGDDVTIQAVYFTGAAAQAGDSRIYGGIHLKDGDLKGQIIGYITGLKV
FT                   SRKIDSLEQGISLEELSSLPVQSFGTMKSDILTGLSMEDFDEISVHQLYAFDGDDTLIA
FT                   KGESLWQLYGGSGMDTFQLFETGSVSLRDYERMEEIELASTIFQQGESIDDIQFTISAT
FT                   GPFTDVSINDRLLFVMDGYWISDDVSVSILA"
     gtgctgttct cgattctatt taagggcaag ctaggaaacg tatacaattc atttctctat        60
     tctttttggg gtaaaaagtc aagcgctagc ccttatgata agacctcttt gggcgacaat       120
     cgagatgaac ccgaatttga tttagtctca agtattgacg aaaaagcaaa gcttgcatta       180
     acggtcttta gtggcgacat taagatagcg cctaatggct tggaattaaa taatgatatt       240
     gaactacagt ctactggctt ggagctaaat agtgatactg agttcaagcc tactagcttg       300
     gagttaagta atgatattga gttacagtct aatggcttgg agttaagtaa tgatattgag       360
     ttgcagtcta atggcttgga gttaagtaat gatattgagt tacagtctaa tggcttggag       420
     ttaagtaatg atattgagtt acagtctaat ggcttggagc taaatagtga tattaaattg       480
     aaatcagttg actttttccc tgaatcccaa ttcgtctctg acgggaatga gatcaatgtc       540
     actttagagt cttccactca aatctcaggc atcaatgctc tgccgacaac ttttaaaatt       600
     caatctgaga ctggcacacc gcgtgctaac tcatctctca tttcttttgc tgattcttcc       660
     tcacagaatt ttagcgcaaa gagtctactt gctccttggt tagatttaat caaagagccg       720
     gtcgtcaaca gtggctcttt tcaggatgcc ttctcttctg tgggcaactt taattcgcta       780
     attaaaaata tattacagct taatccctca tcattgaaaa tacagccttt agagaatcta       840
     gctggtgtat ttgacacggc tgatcatctt ttagcatgga atacccttgc tttagatttt       900
     gcgactgctt cagtcagcgg tccaactcca tgctcccgct tttttggtta tctcaatata       960
     agccaatggg attcttgggc agtctttgag gatacggcta taggctcaat ttataataag      1020
     gagaagcaag caagttttat ttctctactt gatagctttg agatttcgtc caatgactta      1080
     gctgaattta aatgtctata tcaagcttct acgaaaattg ttcaggagat cctggaacat      1140
     gctgtgcgcc aagtggcaat ggatgtttct gcatttaatg tagtctctgg catagagacc      1200
     tcgttgttta aagagggaat acctgagagc ctggttggtg ctgctcaaaa gctactggca      1260
     aaaaatttag atttgtctga gctaggaaaa aaaattggtg atttggttgt ctctatcgga      1320
     accaatattg gtgagacagt ttcgtcaagc attaatcagt atgcattagg agatggctcc      1380
     aatcagcttg gattttatgc agatactact gactatatcc cctccccaag tgtgtatgat      1440
     cctaatgacc ctaatacaaa aatagattca tcctggcagc ctctagaggg gcaaagtgca      1500
     ctgactcctc aatggggagc ggtaacacca tttgcaattg aacctgataa tttaattcca      1560
     tctagtagta ttgtcacacc ctatacagaa cttggtgaac tcaatagtga ttttatagat      1620
     gaattgatga atgtcagaga taaacgtcta aatctcactg cagaagaagc agcaattgct      1680
     gagtattatg agggtggacc atttacttct ttccctccag gtctatggca acaacaatcc      1740
     gttgatctat ctataagccg taatcttgat cttgaccagg ctctaaagtt aaatttgggg      1800
     gtctctcttg ctctgtccga tgctggaata gcgacctgga acctaaaata ttccgcaaac      1860
     acagttcgac ccataacagc aatacgccaa tataagcctg atacagtgtt aagtgacgga      1920
     tcgcttgctg gagattggga accttactta gatactccac cttttccaga tattgcatca      1980
     gggcattcag ctttcagtag ctctgctaat tatattttta atcaatcctt tgaaagcaat      2040
     tactttgatt tttcagtaac cctagcagat gatgattcag tttattctgt cgatggtttt      2100
     gatggaattc caggggttgg tgatgacgtt actattcagg ctgtttactt tacaggggct      2160
     gcagctcaag ctggagattc aagaatttat ggcggtattc atctgaaaga tggagatctt      2220
     aaaggtcaaa taattggcta tattactggg cttaaagtga gccgaaagat cgacagtctg      2280
     gagcaaggta tttctcttga ggaattaagc tcgcttccag ttcaatcatt tggaacgatg      2340
     aaaagtgata ttttgactgg gctctctatg gaagattttg atgaaatttc tgtccatcaa      2400
     ctgtatgctt ttgacggtga tgatacgctt atagcaaaag gagaatcact gtggcaactt      2460
     tatggcggtt cgggaatgga tacctttcaa ttatttgaaa caggctcggt gagtttgcgt      2520
     gattacgaaa gaatggagga gattgaattg gcttcgacca tttttcagca aggtgagtct      2580
     atcgatgata tccaattcac gatatctgct acagggccat ttactgacgt ttctattaat      2640
     gatcgtttgt tgtttgttat ggacgggtat tggatatcag atgatgtaag tgtatcaatt      2700
     ttggcatga                                                              2709
//

If you have problems or comments...

PBIL Back to PBIL home page