(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE261

CP000435.PE261       Location/Qualifiers
FT   CDS_pept        273633..274598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0264"
FT                   /product="probable transcriptional regulator, AraC family,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00165"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47227"
FT                   /db_xref="GOA:Q0IDH2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDH2"
FT                   /protein_id="ABI47227.1"
FT                   /translation="MPQQHVSGSGGIVKLELDQCLSAWVSRIDPRFHSEEDDASLEVAG
FT                   SEYLGSNLSIVKVSSRGHVKSILARNPQDLFSFGISDVGLFRGVAGNREIFSNPQRLAF
FT                   ILLPGESIKLVPAAEFFSGYIFHIKSEYLLSESIKHGTQLPSLLTLHDAIPGHEQLILA
FT                   CANQLLKFFALGDEIGSLRVLQPLEESIVSLLATLISVEPDLLVSGKQAQSQPSYVQIA
FT                   LSYMENNINKNITLSDLCIACSVSGRTLQVAFQAVMSRTPLQVLQELRLNRLRDKIIDG
FT                   MDISSACEQVGIQHSGRISAKYKQLFGELPRNTRSRRTRS"
     atgccccaac agcatgtatc tggatctgga ggcatcgtga agcttgagct tgatcaatgc        60
     ctttctgcgt gggtctctag aattgatcca cggtttcact cagaagaaga tgatgcatca       120
     ctggaagttg ccggatctga gtatttagga agtaatctat cgattgtcaa agttagctct       180
     aggggacatg taaaaagtat tcttgctcga aacccccaag atcttttctc ttttggtatt       240
     tctgatgttg gcctttttag aggtgtggcg ggtaatcgtg aaattttttc aaaccctcag       300
     cgtcttgctt ttattcttct tcctggagag tcaataaagc tcgtcccagc tgcggaattt       360
     ttttctggtt acatatttca tataaagtcg gaatatctgt tgtctgaatc tatcaagcat       420
     ggcactcagc tgccgagtct ccttacgctt catgacgcta ttcctgggca tgagcaactt       480
     atattggctt gtgctaatca attgttgaag ttctttgctc ttggagatga gattggcagc       540
     cttcgagtcc ttcagccgct tgaagaatca attgtttcac tattggctac attgattagt       600
     gttgagcctg atttgcttgt tagtggaaag caggctcaat ctcagcctag ttatgtgcag       660
     atcgcacttt cttatatgga gaataatatt aataagaata tcactctttc tgacctttgt       720
     atcgcctgta gtgtctccgg tcgtactttg caggttgctt ttcaggccgt tatgagtcgc       780
     acacctctgc aagttctgca ggaattacga ctcaataggt tgagagataa aattattgat       840
     ggaatggata tatcttctgc ctgcgaacag gttggaatcc agcatagcgg acgtatttcg       900
     gctaaatata aacaattatt tggcgagttg cccagaaaca cccggtctcg acgcactcgc       960
     tcttaa                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page