(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE265

CP000435.PE265       Location/Qualifiers
FT   CDS_pept        complement(277897..279561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0268"
FT                   /product="Glycine betaine transporter"
FT                   /note="identified by match to protein family HMM PF02028"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47714"
FT                   /db_xref="GOA:Q0IDG8"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG8"
FT                   /protein_id="ABI47714.1"
FT                   /translation="MILWPVLPAAINPLQTSPAGAINATPCAPESLLIRPLSESPTPVR
FT                   SSLSQPPLWVGAIPLLIFLLVSAIDLALAKHFTETGKTIVSHALGGLWQWMVMLLFLIA
FT                   LAIAISPVGKLRLGGATAKPSLKFFDWCAVLICTLLAGGGVFWSAAEPLYHFQTPSPVF
FT                   EGVVGSTAAAVDPALAVSFLHWGFLAWALVATTTTITFSILEQRGEPLWPRTLLVNILP
FT                   KGWVNGPIGDLADGLSVVAAIAGTVGPLGFLSLQLSNAAGQLPWLSDSAGLQSLVVVLL
FT                   TAVFATSTVSGIQKGIKWLSELNVWLTLVLGAGLLILGPGIWLIQHFFSGFWTYLLHLP
FT                   QMALMPRSDVTEPWLNSWTVFYWGWFLGYAPLMGLFTAGVSRGRSIRELVLAVAILCPI
FT                   VTNLWFTLLGGTGMNLELAGSGISDALAQNGAAAALLAILSALPLSGLLIPIGLLLVVL
FT                   FMCTSADSMSYAAAMVVSGRNEPSQRLRLFWALMIGSLTLVLLRIGTGLGDSTSIDALQ
FT                   AFIVITAVPVTPLVLFTLWSAPRLAFKEWQRSGQSAE"
     gtgattctct ggcccgtctt gccagcggcg atcaacccgc tgcagacatc tcctgctgga        60
     gccatcaacg cgacgccgtg cgcgcctgaa tctttactga tacgaccttt gtctgaatcc       120
     cccaccccag tccgctcgtc tttgagccaa ccaccccttt gggttggtgc cattccgctt       180
     ctgatttttc tgctggtctc cgccatcgat ctggcgttag cgaagcactt cacggaaacc       240
     ggcaaaacca ttgtcagcca cgcgctcggg gggctctggc aatggatggt gatgctgctg       300
     ttcctgatcg cccttgccat tgccatcagt ccggtcggga aacttcggct tgggggagca       360
     acagcgaagc ccagtctgaa atttttcgat tggtgtgctg tcttgatttg caccctgcta       420
     gctggcggcg gtgtgttctg gtctgcagct gagccgctct accactttca aaccccctcc       480
     cctgtcttcg agggagtggt gggaagcaca gcggcagctg ttgatcctgc tctagccgtg       540
     agctttctgc actggggctt tctcgcctgg gcgctcgtgg ccaccaccac cacgattacc       600
     ttttccattt tggaacaacg aggcgaaccg ctgtggcctc gcacgctcct ggtcaacatc       660
     cttcccaagg gttgggtgaa tggtccgatt ggagatcttg cagatggcct ttcggttgtt       720
     gcggccatcg caggcaccgt tggcccgctg ggtttcctgt cgctgcaact cagcaatgca       780
     gcaggacaac tcccatggct gagcgatagt gccggacttc agtccctggt ggtggttctg       840
     ctcactgcag tctttgccac atccaccgtg agcggaatcc aaaaaggcat taagtggctg       900
     tcggaactca atgtttggct aacgctcgta ttaggagctg ggttgctgat cctcggtcct       960
     ggaatctggc tgatccagca ttttttcagc ggtttttgga cctacttgct gcatctacct      1020
     cagatggcct tgatgccgcg atctgacgtc actgaaccct ggttgaacag ctggactgtt      1080
     ttctactggg gctggttttt gggctatgca ccactcatgg gtctgttcac ggcgggagtg      1140
     agccggggcc gcagcatccg tgaacttgtt ctcgcggtag ccatcctctg cccgatcgtg      1200
     accaatctct ggttcacctt gcttggtgga acaggaatga acctggaact cgcagggtca      1260
     ggcatcagtg atgcactggc gcaaaacgga gctgctgccg ccttgcttgc gatcctgagt      1320
     gcccttcccc tatcaggctt gctcatcccg atcgggcttc tgttagtggt gctattcatg      1380
     tgcacaagtg ccgattcgat gagttatgcc gccgccatgg tggtgagcgg acgcaatgag      1440
     ccatctcaga ggttgaggtt gttctgggcc ttgatgatcg gcagcctcac cttggtgtta      1500
     ttgagaatcg gaacgggctt aggggacagc acctcaattg atgccctcca agccttcatc      1560
     gtgatcacag cggtgcccgt cacaccactg gtgttgttca cgctgtggag cgctccaaga      1620
     ctcgctttca aggaatggca acgcagcggt caatctgctg aatga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page