(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE271

CP000435.PE271       Location/Qualifiers
FT   CDS_pept        284934..286436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0274"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46882"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG2"
FT                   /protein_id="ABI46882.1"
FT                   /translation="MGATPLADKPLTDRLLRSWVRCRRRAWLDRHANPDDRLYTAHRTL
FT                   QLDDQQRSFVALLPGKPGYGLAACKRGDTGVVGVRLRGVLLDDSAPKGLDLEAHPPLLE
FT                   RVKGASRWGDFAYRPVIARQGRRLNREHRLQLALAGRLLVEFQGGPVPNGLAVAGAGRR
FT                   LERERLPLGSSLNRQLEESLLRLSADINRPDPPALAADRRKCTLCSWRGLCNDVASQEG
FT                   HLSEVSGIGAKRREMLQDIGINSLQALAAANPKELGGQLKRFGDQHAAMAAPLVAQARV
FT                   QRDGVVKRLDALPALPELRNAPGVLLYDIESDPDARDDFLHGFVRLPNDGLPNDDVHSW
FT                   DLKRATYHPLLVLQEHGEKRCWQRIRKFLATYPDWLILHYGETESLALLRMAKRQGASD
FT                   QEQQALRERLIDVHARLRAHWQLPLSSYGLKAVAGWRGFKWSQSGVDGARALLWWRQWR
FT                   GEGVKARGSCHALRWILTYNRDDGLATWAVAQWLLSGDQRPA"
     atgggtgcca cccctctcgc tgacaagcca ctcacggaca ggttgctgcg cagttgggtg        60
     cgctgccgaa ggagggcatg gctcgaccgc catgccaatc cagatgatcg gctctatacc       120
     gcgcatcgca cgctgcagct cgatgatcaa cagcgcagtt ttgtggccct gctgccgggt       180
     aagccagggt atggcctggc agcttgcaag cgcggtgata ccggtgtggt gggggtgaga       240
     ttgcgcgggg tcctgctgga tgactcagcg ccaaagggtt tggatctaga ggcccatccg       300
     ccactgcttg aaagggtgaa aggggcgagt cgctggggtg actttgccta tcggcccgtg       360
     attgctcggc agggccgccg attaaacaga gaacatcgtt tgcagctggc cctggctgga       420
     cgcctgttag ttgaattcca gggtgggcca gtgcctaatg gccttgcggt ggctggcgcg       480
     gggcgacgct tggagcgtga gcgtcttcct cttggcagca gcttgaatcg ccagcttgaa       540
     gaatctctgc tgagattgtc ggccgacatc aacagaccag atccgccagc tttggcggca       600
     gatcgccgca aatgcacact ctgtagttgg cgggggctct gcaacgacgt tgcgtctcaa       660
     gaagggcatc tcagtgaagt gagtgggatt ggcgccaaaa ggcgggaaat gcttcaagac       720
     attgggatca atagcctcca ggccctagcc gcagccaacc ccaaggaact tggcgggcag       780
     ctcaagcgct tcggcgacca gcatgcagcg atggcggccc ctttggtggc tcaagcccgt       840
     gtccagcgag atggggttgt gaagcgtctt gatgctctcc ccgcattgcc tgaattgagg       900
     aatgctccag gggtgttgct ctacgacatc gaatcagatc cggatgcccg cgatgacttt       960
     ttgcacggat ttgtgcgctt gcccaatgac gggttgccta atgacgacgt ccacagctgg      1020
     gatctaaagc gtgccacgta tcacccgctg ctggtgcttc aagagcatgg tgagaagcgt      1080
     tgttggcaaa ggatccggaa atttcttgcc acctatcccg attggctgat ccttcactac      1140
     ggcgaaaccg aatcgctggc tctcttgcgc atggccaaac gccagggggc ttcagatcaa      1200
     gagcagcaag ccctgcgaga gcggttgatt gatgtgcatg cccgtttgcg tgcccattgg      1260
     cagctccccc tcagcagcta tggcctcaag gccgtagcgg ggtggagagg atttaagtgg      1320
     agccagtcag gggtcgatgg agcgagggct ctgttgtggt ggcgtcagtg gcggggtgag      1380
     ggggtcaagg cgcggggctc ctgccatgcc ttgcgttgga ttcttactta caaccgcgac      1440
     gatggattgg ctacatgggc ggtggcccaa tggttgttga gtggtgatca acgcccggcc      1500
     taa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page