(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE272

CP000435.PE272       Location/Qualifiers
FT   CDS_pept        complement(286433..287287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0275"
FT                   /product="Glycine cleavage T-protein (aminomethyl
FT                   transferase) superfamily protein"
FT                   /note="identified by match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45090"
FT                   /db_xref="GOA:Q0IDG1"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDG1"
FT                   /protein_id="ABI45090.1"
FT                   /translation="MSQLLWDHNFPVLRLEGSGSRTFLQGQTSADVQQAEEGDLLPACW
FT                   LDATGRVQALLEIRMDATGADVLVLAGAVDAVSQGFDRVIFPADRVRLKGIRQQRRQEL
FT                   LVQAQPMEPVNVFWTEDEPSASDRFPASEAANATQLDRWRIGQGWPLSAGELDGTTNPF
FT                   ELGLSPWVHLNKGCYLGQETVAKLASKGEVKQQLRSWRAFSSELQGTVPQRGTVLRRQG
FT                   ERAGVITSALEIASAEGLPQEWIGLALVRRQALADPQLSLDNDQGSIQLFKPQAFSEPP
FT                   KRV"
     atgagccagc tcctttggga tcacaacttc ccagtgctgc gactcgaagg gagtggcagc        60
     cgcacgttcc ttcaaggtca aaccagcgcc gacgtccagc aggctgaaga gggcgatctt       120
     ctgccggcct gctggcttga tgccaccgga cgggtgcagg ccctgcttga aatccgaatg       180
     gacgccacag gcgctgatgt gctcgttctg gcgggtgccg tggatgccgt tagccaaggg       240
     ttcgatcggg tgatttttcc cgccgaccgc gttcgcctca aaggaatccg acaacaacga       300
     cgacaagagc tgctggtcca agcccagcca atggagccag tcaatgtgtt ttggacagag       360
     gatgagccga gcgcaagcga tcgcttcccc gccagtgagg ccgccaacgc cacccaactc       420
     gatcgttggc gcatcggaca ggggtggcct ctcagtgctg gcgaattaga tggaaccacc       480
     aatccctttg aactgggcct ctctccctgg gtgcacctca acaaagggtg ttatctgggg       540
     caggaaacgg tggcaaagct cgcttctaaa ggggaagtca agcaacaact gcggagttgg       600
     cgggccttct ccagcgagct tcaaggaact gttcctcagc ggggcaccgt gctgcgacgc       660
     cagggtgaac gtgctggtgt gatcacctct gctcttgaga ttgcgtctgc tgaggggttg       720
     ccccaggaat ggattggcct cgccctggtg cgtcgacaag cattggcaga tccccaactc       780
     agcctcgaca acgatcaagg atcaattcag ctgttcaaac cgcaggcctt ttctgagccc       840
     cctaaacgcg tttag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page