(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE296

CP000435.PE296       Location/Qualifiers
FT   CDS_pept        310215..311339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0301"
FT                   /product="glycosyl transferase, group 4 family protein"
FT                   /EC_number="2.7.8.-"
FT                   /note="identified by match to protein family HMM PF00953"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46426"
FT                   /db_xref="GOA:Q0IDD7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDD7"
FT                   /protein_id="ABI46426.1"
FT                   /translation="MTFASTPLAVASASLVVAAVITTLLVPLVRGLGLRLGLTDQPDSR
FT                   KQHTTPMVRLGGIALVLGFCLSLGVTWWMGGFGMLAPARDQLIWTTLAGSLCFFVIGLA
FT                   DDLFALSPWPRLAGQIAVSMVVWSQGVRIGAIDLPWVASSSEALLLPDLLSLAATVIWL
FT                   VGITNAINWLDGLDGLAAGVAGIAAVGLVSVSFSLHQSAAAFLAAALAGSCLGFLRHNF
FT                   NPARIFMGDGGSYFLGFTLAAVSIVGPAKGLTTVSLLLPLLILSLPLADMSAVIMGRLS
FT                   DGHSPFYPDRRHLHHRLLRAGFSHRRTVLLIYVFTQWLASLAMVVANVEMRFLWLGLAT
FT                   AILVATVVTINRQRHLEAAIEPSELDPSATDRHG"
     gtgacgttcg cgagtactcc tctcgcagtc gcttcggcga gtctggtggt cgctgctgtc        60
     attacgacgc tgcttgttcc cctagttcgt gggctgggtt tgagattagg tctcacggat       120
     cagcccgatt cgcgcaaaca gcacaccacc cccatggtgc gattgggggg cattgcctta       180
     gttctgggtt tttgtttgtc ccttggggtg acgtggtgga tgggcgggtt tggcatgttg       240
     gccccggccc gtgaccagct gatctggacc acgcttgcag ggtcgctctg cttcttcgtc       300
     atcggtcttg ctgacgatct attcgccctg tccccttggc cgcgcctagc gggtcagatc       360
     gctgtttcga tggtggtttg gtctcagggt gtccgtattg gagcgattga tctgccctgg       420
     gtagcaagca gctctgaagc cttgctgctt cctgatctgc tcagcttggc cgccaccgtg       480
     atttggctgg tggggatcac caatgcgatc aactggcttg atggtcttga cggtttggcc       540
     gcaggtgttg ctggaatcgc agcggttggc ttggtgtcag tgagtttttc gctccatcag       600
     tcagcggctg cttttcttgc tgccgcgtta gctggcagtt gccttggctt cctccgccac       660
     aacttcaatc cggcccgcat ctttatgggt gatggcggat cgtatttttt gggattcacc       720
     ttggccgccg tgagcattgt gggtccggca aaagggctga caacggtgag cttgttgctg       780
     ccgttgttga ttctttcgtt gcccttggca gatatgtcgg ccgtgatcat gggacgtctc       840
     agcgatggtc actccccctt ttatccagat cgccgccatc tccatcaccg ccttcttcgt       900
     gctggcttta gccatcgacg cacggtcctt ttgatctatg tgttcaccca gtggttggca       960
     tcgttggcca tggtggtggc caacgtggaa atgcgttttc tctggcttgg gctggctacg      1020
     gccatccttg tggccacggt tgtgaccatc aatcgtcagc gtcatctcga ggcggcgatt      1080
     gaaccttcag aactggaccc ttcagccact gaccgccatg gctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page