(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE309

CP000435.PE309       Location/Qualifiers
FT   CDS_pept        complement(323400..323852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAE22008.1"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46424"
FT                   /db_xref="GOA:Q0IDC4"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC4"
FT                   /protein_id="ABI46424.1"
FT                   /translation="MTRVVALDPGRSKCGLLLANISTNTVLKAMVIPSAEVLDQLRAWM
FT                   EDDQGENAQIADLVIGDGTSSTIWQQQLPTSLKVHVVDETGTTLRARERYWQLWPARGW
FT                   KRLLPLGLRIPSGDLDAIAALVILEDYLDRPLQWPGPDPLKNGPSR"
     atgacacgcg tcgtcgcctt ggatcctggc cgaagcaaat gcggattgct tctagcaaac        60
     atctcaacga acacggtgct gaaagccatg gtgatcccaa gcgctgaggt gctggatcag       120
     ctgcgcgcct ggatggaaga cgatcagggg gagaacgctc agattgctga tctggtgatc       180
     ggtgacggca ccagcagcac gatctggcaa caacaacttc ccaccagcct gaaggtccat       240
     gtcgtggacg aaacaggaac caccctgcga gcccgcgagc gttactggca gttgtggcct       300
     gcacggggct ggaagcgctt gcttccttta ggcctgcgca tcccgtctgg tgatctcgac       360
     gccatcgccg cgctcgtgat cctcgaagat tatttagatc ggccgttgca atggccaggt       420
     cccgatcccc tcaaaaacgg gccctcacgg tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page