(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE31

CP000435.PE31        Location/Qualifiers
FT   CDS_pept        complement(36449..37522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0031"
FT                   /product="peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin-type"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00160"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47117"
FT                   /db_xref="GOA:Q0IE52"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE52"
FT                   /protein_id="ABI47117.1"
FT                   /translation="MAHRRLTALLLAWLAAFGLWLAKPVWADLPQGNAVQDPAAILRDS
FT                   LPMNQEDLRELQHRLESTSNDLRAKRWGALGRTVSRTQKLVATQGNNIVEAVPEEQRSQ
FT                   AELLLNEVRSDLVKLQDEADANDRDGFIQIRRDTLSRIGDLEALLIDDRLPDIPSEFDA
FT                   LPRLAGRATVVIETTQGNLTAVVDGYNAPLTAGAFIDLSLKGFYDGLPFNRAEDFYILQ
FT                   TGDPEGPDIGYVDPKTKQERHVPLEIRIPGETDTLYNETFEDVGLFKAAAVLPFSTLGT
FT                   LGWAHSDQALDDGSSQFFLFLYEAELTPAGLNLVDGRNAAFGYVVDGFDVLEELGVDDG
FT                   IKRIQVIEGADRLQAHA"
     ttggctcacc gccgtctgac cgctctgctt cttgcctggc tagccgcctt tggcctctgg        60
     cttgccaaac cggtatgggc agacctgcct caaggcaatg ccgtacagga tcctgcggcg       120
     atcctgcgcg attcattgcc gatgaatcaa gaggatctac gcgagcttca gcatcggctg       180
     gaatccacca gtaacgattt acgtgccaaa cgctggggtg ctttgggccg cacggtgagc       240
     cgcacccaaa aactagtggc cacccaaggc aacaacattg ttgaagccgt tcctgaagaa       300
     caacgcagcc aggcagagct gctgctcaac gaggtgcgct ctgacctggt caagcttcag       360
     gacgaggcgg atgccaatga tcgagatgga ttcatccaaa tccgtcgcga caccctgagc       420
     cggatcggtg atcttgaagc acttctgatc gacgatcgtc ttcctgacat cccttccgaa       480
     ttcgatgcct tgccacggct tgctggacgg gcaaccgtgg tgatcgaaac aacgcaagga       540
     aacctcacag ccgttgtgga cggttacaac gctcctctga cagcaggcgc ctttatcgat       600
     ctcagcctga aaggctttta tgacggcctc cctttcaatc gcgccgaaga tttctacatc       660
     ctgcaaaccg gagatccaga aggtcctgat atcggctacg tggacccaaa aaccaaacaa       720
     gagcgacacg ttcccctaga gattcgcatt ccaggcgaaa ccgacaccct ctacaacgaa       780
     accttcgaag atgttggcct gttcaaagca gcagcagttc ttcctttctc cacccttggg       840
     actctgggct gggcccattc cgaccaagcc cttgacgatg gatcgtcgca attcttcctg       900
     ttcctctacg aagcagaact cacccctgct ggtctcaacc ttgtagacgg gcgcaatgcc       960
     gccttcggct acgtggtgga tggctttgat gttctcgaag aactgggcgt cgacgacgga      1020
     atcaaacgca tccaggtgat cgagggcgcc gatcgactcc aagctcacgc ctga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page