(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE310

CP000435.PE310       Location/Qualifiers
FT   CDS_pept        complement(323849..324898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0315"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45610"
FT                   /db_xref="GOA:Q0IDC3"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDC3"
FT                   /protein_id="ABI45610.1"
FT                   /translation="MGKARLSLLGLRPKRTAVVITVLTGSLISALSLGLLLLVSRQLRV
FT                   GLFELNALEAKLRSSRSDLKTSKRAQKQAGKELTTAQQRAAELRRTLKPLQEQTRSLEA
FT                   ERQRLSQDVDAKDVEIQRTEQELSAVRSQIRSGEKELNELEDTLLALRRGNVAISSGQP
FT                   LTTVTLKLERPDQAKTVIDQLLRDANLQAYQQVLPGQPVERQLLLVPRPDIKRLEQTIR
FT                   KPGTWVVNIRSAANVLLGETVVYAFPEVLPNVTVTREGEILARTTVASNERNPEAVRNR
FT                   LNLLLASTLAEVQRRGSLSKGLQFDGNAINALGQELIDRNGGLATLEAVALRRSETADP
FT                   IAIQLRLSP"
     gtggggaaag ctcggctgag cttgcttggg ctgcgtccga agcgcacagc cgtggtgatc        60
     acggtgttga cgggcagcct gattagcgca ctgtccctgg gactcttact tttggtgagt       120
     cggcagctca gggtcggcct ttttgaactc aatgctctcg aagcgaaatt gcgaagcagt       180
     cgctccgacc tcaaaacaag caaacgcgct cagaagcaag ccggcaaaga gctcacaaca       240
     gcccaacagc gagcggcaga actgcgtcgc accctgaagc ccctccagga acaaacccga       300
     tccctggaag cagagcgcca gcgcttgagc caagacgtgg atgcgaaaga tgttgagatc       360
     caacgcaccg aacaggaact ctcggccgtg cgctcgcaaa ttcgcagtgg cgagaaagaa       420
     ctcaatgaac tggaagacac tcttctcgct ctgcggcgcg gaaatgtcgc catcagcagt       480
     ggtcagccac ttaccaccgt gaccctgaag ctggaacgcc ccgatcaggc aaaaacggtc       540
     atcgatcagt tgctacgaga tgccaatctt caggcctatc aacaagtgct gcctggccaa       600
     ccggtagagc gtcagctcct gctggttccg cgacccgata tcaaacgctt ggaacaaacg       660
     attcgcaaac ctggcacctg ggttgtgaac atccgttcag cagccaatgt gcttctgggc       720
     gaaaccgttg tgtacgcctt ccctgaagtg cttcccaatg tcacggtgac cagagaggga       780
     gagatcctgg cccgcaccac cgtcgcgagc aatgagcgca accctgaagc cgttcgcaac       840
     cgactgaatc ttctccttgc ctccacattg gccgaggtgc aacgacgcgg ttctctcagc       900
     aagggtctgc agttcgatgg caatgccatc aatgcgcttg gccaagagct gatcgaccgc       960
     aacggcggtc tcgcaacgct cgaagcagtc gctttacggc gtagcgaaac agcagatccg      1020
     atcgccatcc agttgcgtct cagtccatga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page