(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE318

CP000435.PE318       Location/Qualifiers
FT   CDS_pept        complement(329914..331989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0323"
FT                   /product="transglycosylase, SLT family protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45427"
FT                   /db_xref="GOA:Q0IDB5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB5"
FT                   /protein_id="ABI45427.1"
FT                   /translation="MPPVSGRGLTVQHSRGLLLLAGTPLLTVALVLGGQTLMRRLHTPL
FT                   TPSISNADLWTHYRWSINPSERREAALLLAARSADSADRSQRLLANQGWGNDPIAAVTL
FT                   KQQALTAAKLGQPSEEQKRWQDLLQRFPDSAASADARYQLGQAHPALHTELFRQQPGHP
FT                   AALAAAAETKTESPKQAIAALHLARWGARWPGAATQLREACNRISGDGLNQDDRLTLAR
FT                   GLASLGDGGAAEACLQGTPTTPASALAIGRVLLRGTAEQQGRGKQHLLELAINNPDDPA
FT                   ALEAAALLSEPLKPDPALLDALPQALQQRSADVAAARVRLGDSANGDASNAMSVLKRWP
FT                   TNPAAWQLQWDLAREALLKDQWQTAESLLRAIPSSNLPEPLAARQQFWLGLTLSKQDQT
FT                   TQAQQVWQHLVKTHPRSYYTWRAEVRLGRGDLPDLHQASASRSAGLGDSFQSPWEPLQS
FT                   GDSFVDRLWRLGQTQEAWETWRNQQPPSDQPTNPEQKLVEGRLRIAVGDSWTGLSRLWR
FT                   ASLRLVNQSCEERQLLHRSQHPRLLSQVFERASQQEAVRNELLMAIAKQESRFSPGVSS
FT                   PVGAVGLLQLMPATAEELAGDALSQDQLREPTRNARLGARYLGHLLEQWQGDIVLAVAS
FT                   YNAGPGAASQWVTPALKNDPELWIERIPYPETRLYTKKVLGNLWAYLGSGTDRCDS"
     atgccaccag tttccggccg aggcttgacc gttcaacact cccgtggcct tctgcttctc        60
     gctggaactc cactcctcac cgttgcgcta gtcctcggcg gacagacgct catgcgacgt       120
     ctgcacactc cactcacgcc atcgatttca aacgctgatc tctggaccca ttaccgctgg       180
     tcgatcaatc ccagtgagcg aagggaagca gctctcttac tagcggcgcg cagcgccgat       240
     tcagcggaca gatcccagcg tttactggcc aatcagggct ggggcaacga tcccatcgct       300
     gccgtcacgc tgaaacagca ggcgttaacc gcagcaaaac tcggccagcc gtcagaagaa       360
     cagaaacgtt ggcaggactt gcttcaacgc ttccctgaca gtgccgccag tgccgatgcc       420
     cgttatcaac tagggcaagc ccacccagcg ctccacacag agctgttccg gcaacaacca       480
     ggtcatccag ccgccttagc ggcagcagca gaaaccaaaa cagaatcccc caagcaagcc       540
     atcgccgcct tgcatctagc ccgctggggc gcccgatggc caggagctgc cactcagctc       600
     agggaagcct gcaacaggat cagcggcgat ggcttgaacc aagacgatcg actgacgctc       660
     gcccgaggac tggcttccct cggtgatggc ggtgcagcgg aagcctgcct tcagggcaca       720
     cccaccactc cagccagcgc cttggccatt ggtcgggtcc tgctccgagg caccgctgaa       780
     cagcaagggc gtggaaagca gcacttgctt gagctcgcca tcaacaaccc cgatgatccg       840
     gcggctctcg aagcagcggc gctgctgagc gagccgctga aacccgatcc cgctctattg       900
     gatgcactgc cgcaagcttt gcaacaacgc tccgctgatg ttgcagccgc ccgggtgcgc       960
     ctcggtgact cggcgaatgg tgacgcatcg aacgccatgt ccgttctgaa acgatggcct      1020
     accaatccag ccgcatggca actgcagtgg gacttggccc gcgaggcact tttaaaagat      1080
     caatggcaaa cagcagaatc actgctaagg gccattccga gctcaaatct tcctgaaccg      1140
     ttggccgcaa ggcagcagtt ctggctggga ctcacactgt cgaagcaaga ccaaacaacc      1200
     caagctcagc aggtctggca gcacttggtc aaaacccatc caaggagtta ttacacctgg      1260
     cgcgccgagg tgagactggg acggggagat cttcctgatc tccatcaagc atcagcctct      1320
     cgctctgcag ggctcggcga ttcgtttcaa tcaccttggg agccactcca aagtggtgat      1380
     tcatttgtgg atcgtctctg gcgactcggc caaacccagg aagcatggga aacctggagg      1440
     aaccaacaac cgccatccga tcagcccacc aatccagagc aaaagctcgt ggaaggtcgt      1500
     cttcgtattg ccgttggaga ctcatggaca ggtctgagtc gtctttggcg cgccagtttg      1560
     aggctcgtga atcaatcctg cgaggaacgt cagctcctcc atcggagcca gcatccgcgt      1620
     ctgctctcgc aggtgtttga gcgcgcatca caacaggagg cggtacggaa tgaactgctg      1680
     atggcgatcg ccaagcaaga atcccgtttc tccccaggcg tcagctcacc cgtgggggcg      1740
     gtcgggttgc ttcagctgat gccagccaca gcggaagaac tcgccggcga tgcactgagc      1800
     caggatcaac tacgcgagcc aacacgcaac gcaaggctcg gagcgcgcta tctcggtcac      1860
     ttgctggagc agtggcaggg agacattgtg ctggccgttg cgagctacaa cgcagggcct      1920
     ggggccgcca gccaatgggt cacaccagct ttgaagaatg atcctgagtt atggatcgag      1980
     cgaattccct atccagaaac gcgcctttac acaaaaaaag tgctgggcaa tctctgggcc      2040
     tatctcggat caggtactga ccgctgcgac agctga                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page