(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE320

CP000435.PE320       Location/Qualifiers
FT   CDS_pept        332286..333653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0325"
FT                   /product="Phosphotransferase superclass"
FT                   /EC_number="5.4.2.3"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47426"
FT                   /db_xref="GOA:Q0IDB3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q0IDB3"
FT                   /protein_id="ABI47426.1"
FT                   /translation="MGQLPKPSKISFGTDGLRGRVDTMLTPALALQVGYWCGRVLQAEG
FT                   PVLIGMDSRSSGSMLVAALTAGLTASGREVWTLGLCPTPAVPGLIRRYSAAGGLMVSAS
FT                   HNPPEDNGIKVFGATGSKLSPERQQAIEAGLCGGDGSGMALAASGAARHRPELLDDYRA
FT                   SLLSSVGQHRLDGVPIVLDLCWGSATACGAEVFSALGADLTVLHGDPDGTRINVNCGST
FT                   HLEALRRAVIEKGAAMGFGFDGDADRMLAVDGQGRVVDGDHVLFLWGSVLQEQGQLPDQ
FT                   RLVATVMSNLGFERAWQARGGLLDRTPVGDQHVHAEMVRTGAALGGEQSGHILSSAHGL
FT                   AGDGVLTALQIASLCHAQQLSLAEWVDQSFQAYPQKLVNVRVENRERRKGWADCAPLSS
FT                   LVQEAEASMAEDGRVLVRASGTEPLLRVMVEAADQAVVDHWTSSLAAAAELHLNAS"
     ttggggcaac tcccaaagcc atcgaagatc agctttggga ccgatggctt gcgtggtcgg        60
     gtggacacca tgctcactcc ggccttggct cttcaggttg ggtactggtg tggacgcgtg       120
     cttcaagccg aggggcctgt gctgattggc atggattcgc gaagtagcgg aagcatgttg       180
     gtcgcggcac tcaccgcagg cctgacggct tcaggcagag aggtttggac tttgggactg       240
     tgtcccacgc ccgctgtgcc aggtttgatt cgccgctatt cagctgccgg tggcttgatg       300
     gtctcggcga gccacaaccc tccggaagac aacggcatca aggtgtttgg agccactggc       360
     agcaagttgt ctcctgaacg tcagcaggcg attgaagctg gtctgtgtgg tggagatggc       420
     tctgggatgg cgttggcggc atcaggagct gcacgccatc gtcctgaact tcttgacgac       480
     taccgcgcga gcttgctgtc cagtgttggg cagcatcgac tcgatggtgt gcccatcgtg       540
     ctggatctct gctgggggtc ggcaacagcc tgtggcgcag aggtgttttc tgcccttggc       600
     gccgatctca cggtgttgca cggtgatccg gacggaacaa ggatcaatgt gaattgcgga       660
     tccacccacc ttgaggcttt acgccgcgcc gtgatcgaga agggcgccgc catgggtttt       720
     ggcttcgatg gggatgccga tcggatgttg gcggttgatg gccaaggacg ggtggtggat       780
     ggcgaccatg tcctctttct ctgggggtcg gttttgcaag agcagggaca gctccctgat       840
     cagcgcttgg tggccacggt gatgtcaaat ttggggtttg agcgggcttg gcaggcgcgc       900
     ggtgggctcc tggaccggac accggtggga gaccagcatg tgcatgccga gatggtccgc       960
     acgggggcag ctcttggcgg cgagcaatca ggtcacatcc tctcttccgc ccatggtttg      1020
     gctggtgatg gtgtcttgac cgctcttcag attgcgagcc tctgccatgc acagcagctc      1080
     tccttggccg agtgggtgga tcagagcttt caggcctatc cccaaaaact ggtgaatgtg      1140
     cgcgtcgaga atcgcgaacg cagaaagggt tgggcggact gtgcgcctct ctcttctctg      1200
     gttcaagaag cggaggcttc gatggctgaa gacggacgtg tgctggtgcg ggcgagtggg      1260
     acagaaccac tgctgcgtgt gatggttgag gctgccgatc aagcggtggt cgatcactgg      1320
     acctccagct tggcggcagc agcagagctg catctcaacg cctcatga                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page