(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE321

CP000435.PE321       Location/Qualifiers
FT   CDS_pept        complement(333648..334640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0326"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family superfamily"
FT                   /note="identified by match to protein family HMM PF01869"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47590"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB2"
FT                   /protein_id="ABI47590.1"
FT                   /translation="MVLPGNPESGPTSHPDRPMSDALILAGFDAGQTHCRCKLSRWHNG
FT                   NWQPLGEGKGSGVSHLQANEGETRFVEAIRSSLDAANPSGLEINAAAVGASGVEQGTAL
FT                   QDRASELLAASLALPIEHCIATGDERIALRGAFPNDAGIVLISGTGMIVVGRNASGLEQ
FT                   RCGGWGWQLDGAGAAFDLGHQGLQLSLRMADGRLPDGPLRNQLWQVLGCRTAAAIKAFV
FT                   VQPNYQPAQLAQLAPLVSAAAEAGNIEAKAILDRSGDALAEAVQAVASSLGLTQPVLCA
FT                   RGGALLNLAPLQQAVNTSLRRRQVDARWDDRSGDACDGALTLALERCRS"
     ttggttttgc ctggcaaccc tgagtcaggc ccaacaagcc acccagacag acccatgagc        60
     gacgccctga ttttggctgg tttcgatgct ggccaaaccc attgccgctg caagttgagc       120
     cgatggcata acgggaactg gcaaccgcta ggcgaaggca agggcagtgg cgtcagccat       180
     ctacaagcca acgagggcga aacacggttc gtggaggcca ttcgcagcag cctggatgcc       240
     gccaatccca gcggacttga gatcaacgct gccgctgttg gtgccagcgg agtggagcag       300
     ggcacagcac ttcaggaccg cgcaagcgag ctgctggcag ccagtctcgc gttaccaatc       360
     gagcactgca tcgccactgg cgacgaacgc atcgctctgc gtggagcatt ccccaacgat       420
     gccggcatcg tgctgatcag cggcacggga atgatcgtgg ttggacgcaa cgccagcggc       480
     cttgaacaac gttgtggggg atggggatgg caactggatg gggctggcgc tgcctttgat       540
     ctcggccatc aggggctgca gctcagcctg cgcatggccg atggccgact cccagacgga       600
     ccgctccgca accagttgtg gcaagttctc ggttgccgca cagccgcagc gatcaaggcc       660
     ttcgttgtgc agccgaacta ccaaccagcc cagctcgccc aattggcccc cctcgtctcg       720
     gccgccgctg aagcaggcaa tattgaggcc aaggccatac tcgaccgctc cggcgatgcc       780
     cttgccgaag ccgtacaagc cgtggcttct tccctggggc tcactcagcc agtgctctgt       840
     gcaagaggtg gcgcactgct gaatctggcg ccccttcaac aagccgtaaa cacgtcttta       900
     cgccgtcgcc aggtcgatgc tcgctgggac gaccggagtg gtgacgcctg cgatggagcg       960
     ctcacgctgg ctctcgaacg ctgcagatca tga                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page