(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE322

CP000435.PE322       Location/Qualifiers
FT   CDS_pept        complement(334583..335926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0327"
FT                   /product="putative inorganic carbon transporter/0-antigen
FT                   polymerase (ICT/OAP) family protein"
FT                   /note="identified by match to protein family HMM PF04932"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46943"
FT                   /db_xref="GOA:Q0IDB1"
FT                   /db_xref="InterPro:IPR006007"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDB1"
FT                   /protein_id="ABI46943.1"
FT                   /translation="MIIPKTLHPHLMAEAPAPPPLLLSWQGVLPASEQQRRRLSWLASI
FT                   LLMVLLAGLPFLTRTGLGLVVLACGALWILWSSVSQPQRIGAISAWVLLFLGIALLATG
FT                   FSPVPAAATKGLIKLLSYLGVYALMRQLLAERPDWWDRLVAALLGGELLTSVMALRQLY
FT                   GPTEELARWADPNSVAAGTIRIYGPLGNPNLLAGYLVPILPLALVALIRWNGWGARCYA
FT                   AVALGLGATATLFSYSRGGWLGMLAALGVLLLLLVLRAIRNWPKLWRRLVPIALLVLAG
FT                   VALAIAVTQVDPIRTRVASLLAGRGDSSNNFRINVWLAAVEMIQDRPWLGIGPGNAAFN
FT                   AVYPLYQQPKFNALSAYSVPLELLVETGIPGLIAALGLAGASLRNGLRALRSTAALALP
FT                   WLGCLAAIAGLVIQGATDTIFFRPEVQIIGWFCLATLSQAQQATQTDP"
     ttgataattc caaagacgct gcacccacac ctcatggctg aggctccggc cccaccacct        60
     ttgttgctga gctggcaagg agtcctgccc gctagtgagc agcagcgacg gcgcctgagt       120
     tggttagcca gcatcctgct catggttctg ctcgcaggac tgcccttcct cacccgaacg       180
     gggttaggcc ttgtggttct ggcctgcgga gcgctgtgga tcctctggtc cagcgtgagc       240
     caacctcagc gcatcggtgc catcagcgcc tgggtgctct tgtttcttgg catcgccttg       300
     ctcgccacgg ggttctcccc tgttccggct gcagcaacaa aaggcctgat caagctgctc       360
     agctacctcg gcgtctatgc cctgatgcgc cagctgctgg ccgagcgacc cgactggtgg       420
     gaccggctcg tggccgcatt gctgggcggc gaattgctca ccagcgtgat ggccttgcgc       480
     cagctctacg gacccaccga ggagctggca cgctgggccg atcccaattc tgtagccgca       540
     ggcacgatca ggatctacgg acccctcggc aaccccaatc tgctggcggg atatctggtg       600
     ccaatccttc cattagcgct cgttgccttg atccgctgga atggctgggg ggcacgctgc       660
     tatgcagcgg ttgcactggg gttaggagct accgccaccc tgtttagcta tagccgcggg       720
     ggctggctgg gcatgctcgc ggcccttggt gtgctgctgc tgctgctcgt gttgcgtgcc       780
     attcgcaact ggccaaaact ttggcgacgt ctcgtcccca tcgccctgct ggtgcttgct       840
     ggagtggcct tagcaatcgc ggtcacgcag gtggatccga ttcgcacgcg agtcgccagc       900
     ttgctagctg gacgaggcga tagctctaac aacttccgca tcaacgtgtg gttggccgca       960
     gtggagatga ttcaagaccg cccctggctg ggcatcggac caggcaacgc cgcatttaat      1020
     gccgtttacc ccctctatca acagccaaaa ttcaatgccc tgagtgccta ttccgttcct      1080
     ctagagctcc tggttgaaac gggcattcca ggcttgatcg ctgcgcttgg gttggctgga      1140
     gccagtcttc gcaacggcct tagagcgctg cgctcaacgg ctgccctggc gttgccctgg      1200
     ctgggctgcc tcgccgcgat cgctggactg gtcattcaag gcgctacgga caccattttc      1260
     ttccgaccag aagtgcaaat catcggttgg ttttgcctgg caaccctgag tcaggcccaa      1320
     caagccaccc agacagaccc atga                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page