(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE327

CP000435.PE327       Location/Qualifiers
FT   CDS_pept        339322..340038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0332"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47770"
FT                   /db_xref="GOA:Q0IDA6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA6"
FT                   /protein_id="ABI47770.1"
FT                   /translation="MHSFLAGLKVARVKGLNLTQRSYGLYVFVLAAIFFGLLMSNSLIL
FT                   LNISGEDGLIENATAGILLGSACLSISQFFIKSSDKKVFLTLSVLGLIGFLDEVSFGDR
FT                   AFKGMYFFRVHGVKIDGIHDVAEVFANLIKTNIVYHALETLGVLAVVFVILICAFAKRA
FT                   PLVKNCTRKIFAYCSSKQILGYWLVIFLCILVSQSIDIFRIKIFSYQAIEEFLELIAAG
FT                   GFMACVISLARGDARG"
     gtgcatagct tcttggctgg gttgaaagtc gctcgcgtga agggacttaa tctgacccaa        60
     cgctcttatg gcttgtatgt atttgtgctg gcggcgattt tctttggtct tttgatgtct       120
     aattcattga ttttgctaaa tatttctggg gaggacggat tgattgagaa tgcaactgcg       180
     ggcatcctcc ttggctcagc atgtctttca attagtcagt ttttcattaa atcaagtgat       240
     aaaaaagtat tccttacctt gtccgttttg gggctaattg gatttttgga tgaggtgagt       300
     tttggggatc gggcctttaa gggaatgtat ttctttagag tgcacggtgt aaagattgat       360
     gggattcatg acgtagcaga ggtctttgca aatttaataa aaacaaatat cgtttaccac       420
     gcactggaaa ccctcggagt acttgctgta gtctttgtga tattgatttg tgcctttgca       480
     aagcgagcgc cattagttaa gaattgcact agaaaaatat ttgcatattg ctctagtaag       540
     caaatattgg gatactggct tgtaattttt ttgtgcatac ttgtgtctca gtctattgat       600
     atttttcgta taaagatttt ctcttatcaa gccatagagg agtttcttga attgattgcc       660
     gctggtggct tcatggcatg tgtgatatct cttgctaggg gtgatgcaag agggtga          717
//

If you have problems or comments...

PBIL Back to PBIL home page