(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE330

CP000435.PE330       Location/Qualifiers
FT   CDS_pept        344430..345449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0336"
FT                   /product="beta-carotene hydroxylase"
FT                   /note="identified by match to protein family HMM PF00487"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46685"
FT                   /db_xref="GOA:Q0IDA3"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IDA3"
FT                   /protein_id="ABI46685.1"
FT                   /translation="MTQALAQPESQGSTPLLRSVPKEFVDPPSAWNPTVALFLGGYGLA
FT                   ALTIWGWFVGGWPLPLLLICGFLALHLEGTVVHDACHKAAHPVPWVNQTMGHGSALLLG
FT                   FSFPVFTRVHLQHHSHVNDPKHDPDHIVSTFGPLWLIAPRFFYHEFFFFQRKLWKRWEL
FT                   MQWGFERAIFFTIIVAAIRFDFLPFIFNCWFAPALMVGVTLGLFFDYLPHRPFLSRNRW
FT                   QNARVYPGRTMNWLIMGQNYHLVHHLWPSIPWFEYKPAYEATKSLLDAKESPQRLGIFE
FT                   TRSDVVNFFYDILIGVRSHKPRGSKMRPIAKFLPSRRLRRGWLSLLKRTAVTPARQRY"
     atgactcaag cactcgcaca accggagagc cagggatcga cgcccctgct tcggtcagtg        60
     cctaaagagt ttgtcgatcc accgtctgcc tggaatccaa cggttgcttt gtttttgggt       120
     ggttatggct tggcagcttt gaccatttgg ggctggtttg taggtggttg gccgttgccc       180
     ctgttgttga tatgtgggtt cttagcactt catttagagg gcacagttgt gcacgatgcc       240
     tgccataagg cggctcatcc ggtcccttgg gttaatcaaa caatggggca cggatcagca       300
     ttgcttttgg gatttagttt ccctgtcttt acgcgggtgc acttgcaaca tcattctcat       360
     gtgaatgatc caaagcatga tcctgaccac atcgtcagta cctttggccc tctctggtta       420
     attgcgccta ggttctttta tcacgagttt ttcttctttc agcgaaagct ttggaagcgt       480
     tgggagttga tgcagtgggg attcgagcgt gcaatctttt ttactattat tgttgctgca       540
     attcgattcg attttctgcc ttttattttt aattgttggt ttgccccagc gctcatggtt       600
     ggagtcacgc tgggcctttt ctttgattac ttgccccaca ggccgttttt gtcgcggaac       660
     cgttggcaga atgctcgtgt gtatccaggt cgcacaatga attggttgat tatgggtcaa       720
     aattatcact tagttcatca tctttggccc tctatcccct ggtttgagta caagcccgcc       780
     tatgaggcga cgaagtctct ccttgatgca aaagaatcgc cgcagaggct aggaatcttt       840
     gaaactcgct cggatgtcgt caatttcttt tatgacattc tgatcggagt tcgaagtcac       900
     aagccaaggg gtagcaagat gcgcccgatt gcaaagtttc tgcccagtag gcgcctgcga       960
     cgaggttggc tgtctttgct gaaaagaacc gctgtcacgc cggcacgtca acgttactaa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page