(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE334

CP000435.PE334       Location/Qualifiers
FT   CDS_pept        complement(346837..347472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0340"
FT                   /product="Transporter"
FT                   /note="identified by match to protein family HMM PF02592"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45905"
FT                   /db_xref="GOA:Q0ID99"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID99"
FT                   /protein_id="ABI45905.1"
FT                   /translation="MLNILGLTRFLTLGQIGAWPIVVAVGALPYPVTFLCTDLISELWG
FT                   EEKATQVVWVGLLLNGWVVLILWLGGLLPGLNGAPESTFFEIQRLAFGSVGASMVAYLT
FT                   AQFVDVRLFHFWKERTNGKALWLRNNGSTLVSQLVDTSAVVLISHYAAHVLPIRAGEAV
FT                   LPQLGAFIASGYLFKALAAFADTLPFIWLTTWLRDWLDIQGDGKEIIP"
     atgctcaaca tccttggcct gacacgcttc ctcacccttg gccagattgg ggcatggccc        60
     atcgtggtgg ccgttggcgc cctcccctat cccgttactt ttctgtgcac cgatctcatt       120
     agtgagcttt ggggggagga gaaagccaca caggtggtgt gggtaggcct cttactcaat       180
     ggatgggtgg tgttgattct gtggctcgga ggtctcctgc ccggcctcaa cggcgctcca       240
     gaatccacct tttttgagat tcaacgcctg gcctttgggt ccgtgggagc atcgatggtg       300
     gcttacctca cggcccaatt cgtagacgtg cggttgttcc acttttggaa ggagcgcacg       360
     aatggcaagg ccctctggct ccgtaacaac ggctccaccc tggtgagcca attggtagac       420
     accagcgccg tggtgttgat cagccactac gccgcgcatg tgttgcccat tcgcgccgga       480
     gaagcggttc ttcctcagct aggagctttc attgccagcg gttatttgtt caaagccctc       540
     gcggcttttg ctgacaccct gcccttcatc tggctcacca cctggttacg cgattggctg       600
     gatattcaag gagacggcaa ggagattatt ccctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page