(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE335

CP000435.PE335       Location/Qualifiers
FT   CDS_pept        347465..347665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0341"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45092"
FT                   /db_xref="GOA:Q0ID98"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID98"
FT                   /protein_id="ABI45092.1"
FT                   /translation="MSIPRVPRKSPASTRNARSRLALIWLVVIVGDADMGFVVHRLRLD
FT                   SLVIRVVLTCHLEWRGWIALS"
     ttgagcatcc caagggtgcc aagaaagagc ccggctagca caagaaacgc caggtcccgc        60
     ctggctttga tttggcttgt ggtgattgtg ggtgatgccg acatggggtt cgtcgttcat       120
     cgtttgcgtc tcgacagtct ggtcattcgg gttgtgttga catgccatct ggaatggcgc       180
     ggctggattg ccttgtcttg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page