(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE338

CP000435.PE338       Location/Qualifiers
FT   CDS_pept        complement(349344..350858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0344"
FT                   /product="NADH dehydrogenase"
FT                   /EC_number="1.6.99.3"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47422"
FT                   /db_xref="GOA:Q0ID95"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID95"
FT                   /protein_id="ABI47422.1"
FT                   /translation="MAAEHFFLELEPPEERLRDAPHVVIVGGGFAGVRACKALAQADVR
FT                   ITLIDKRNFNLFQPLLYQVATGLVAPGDVATPLRQLVGKQRNVQVLLGEVTGLDAKKQQ
FT                   INFSEKILTYDHLVLATGSGSTYFGHEEWRTFAPPMKILEHAQEIRRRLLMAMEQAEQT
FT                   PDPAARKFLQTVVIVGGGPTGCEMAGATSELMRNAMRREFKQLDPDDSRIIVIDPGDRL
FT                   LRAMPESLSASAQKTLESLGVETLFKGRVQSMKPGEVSVGTPDGEQTIQAATVIWTAGV
FT                   RPSHLGKTLAGSIDCELDRGGRVIVEPDFSVKDHPEIRVVGDLCSYKHTSTGNPLPGMA
FT                   GPATQAGGFVGKDIAAIMSGGNRPNFKWFDFGSMAVLDRVAAVADLRGFKFSGSPGWAV
FT                   WAAAHLAFMPDRENRWSLLIKWMFAVLSQQRSSMLLTGMPSQHIGLDSADAPFPMNSGS
FT                   GPSIAAPDAALKAAMNYYANSVSGVSAQDGAEARDDSATGSDAAIK"
     atggctgctg agcatttctt tctcgagctc gaaccgccag aagaacgtct tcgcgacgcc        60
     cctcatgtgg tgatcgtggg cgggggcttc gctggagttc gagcctgcaa agcgcttgcg       120
     caggcagatg tgcggatcac cttgattgat aagcgcaact tcaatttgtt tcaaccgctt       180
     ctttatcaag tagcaacagg cctagtagct cccggtgatg ttgcgacacc cctgcgacag       240
     ctggttggaa agcagcgcaa cgttcaggtc ctgctgggag aagtcacggg cttagatgcc       300
     aagaagcaac aaatcaactt cagcgaaaaa attctcacct acgaccactt agtactcgca       360
     acgggctcgg gcagcaccta tttcggccat gaagaatggc gcacttttgc gccaccgatg       420
     aaaatccttg agcacgctca agaaattcgt cgccgcttgc tgatggcgat ggagcaggcc       480
     gaacaaacac ctgatcccgc ggcacgcaaa ttccttcaaa ccgtggtgat tgtgggaggg       540
     gggcctacgg gatgcgagat ggcaggtgcc acctccgagt taatgcgcaa tgccatgcgc       600
     cgtgagttca agcaacttga tcctgatgat tcaaggatca tcgtgatcga ccctggcgat       660
     cgattgctga gggcgatgcc tgagtcgttg tcggcctctg ctcaaaagac cctggaatct       720
     ctaggggtcg agaccctctt taagggacgt gttcagagca tgaagcctgg agaagtctcc       780
     gttggcactc cagatggcga acaaacaatt caagctgcaa ccgtgatttg gacagccggt       840
     gtacgaccat ctcacctggg caagaccctg gcaggctcga tcgattgtga attggatcgt       900
     ggcgggaggg tgattgttga acccgacttc agcgtgaaag accatccaga gattcgggtg       960
     gttggcgatc tctgcagcta taagcacact tccacgggaa atccactgcc cgggatggca      1020
     ggcccagcaa cccaagcggg cggtttcgtc ggcaaagaca ttgccgcgat catgagtgga      1080
     gggaatcgtc cgaacttcaa atggtttgat ttcggcagca tggccgtgct ggatcgtgtt      1140
     gctgctgttg ctgatctgcg cggcttcaaa ttcagtggaa gcccaggctg ggctgtgtgg      1200
     gccgccgcac accttgcctt catgcccgat cgagaaaatc gctggtcctt gctgatcaag      1260
     tggatgtttg ctgttctgtc gcagcaacgc tcatcaatgc tgctcactgg catgccaagt      1320
     cagcacatcg gtctcgactc cgcagacgct ccgttcccga tgaacagcgg aagcgggccc      1380
     tcaattgccg caccagatgc ggctctcaaa gcagccatga attactacgc caattccgtc      1440
     tccggtgttt ctgctcagga tggcgctgag gcccgcgacg actccgccac aggatcagac      1500
     gctgccatca aataa                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page