(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE340

CP000435.PE340       Location/Qualifiers
FT   CDS_pept        complement(351455..351655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47885"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID93"
FT                   /protein_id="ABI47885.1"
FT                   /translation="MSQSKREQVVSHLRYIRQELREMHQGVMEDGLLPEAGEVRGVMAQ
FT                   MEALLELLEGKSSRKAKADSD"
     atgtcgcaat ccaaaagaga acaggtcgtg agccaccttc gctacatccg ccaggagctg        60
     cgagaaatgc atcaaggcgt gatggaagac ggactcttgc ctgaagcggg tgaagtgaga       120
     ggagtcatgg cccagatgga ggcgttgctt gagctactag aggggaaatc atcccgcaaa       180
     gcgaaagccg attccgactg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page