(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE343

CP000435.PE343       Location/Qualifiers
FT   CDS_pept        complement(352723..354570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0349"
FT                   /product="beta-lactamase, putative"
FT                   /note="identified by match to protein family HMM PF00144"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45463"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID90"
FT                   /protein_id="ABI45463.1"
FT                   /translation="MIHSALDLNNIFLKINQKAKDGIKKATTISAIAATGMVLTTALPS
FT                   SASEWTARHGLSSSSYQQTFNNYTKKGYCLKSISGYQQAGKANYAAIWSKNECKPFIAR
FT                   HGLSPQKYQAAFNAFNKKGYRLTYINGYEIGGKPFYAAIWEKTSGPAYEARHGLTEKQY
FT                   QSQVTSMSGKGYGIKHVSAFSLKGSPRFAVIFEKNMPTWKARHGLTHSQYQKEFNKSAK
FT                   EGYRLKVVTGYRKGNSDRYAAVWTKEGGQYYQARHSIPTKNYQHIFDNYRYQSYEPKYI
FT                   EAFNSASGVKFNGVWENKKFASKSLRSIERKVGQYMRDNNIKGLSIAISKNNKLVYARG
FT                   FGKADITKGIAVGPKHRFRIASVSKLVTQAAIKKLLKETSLNSNSKVFGKNSILGDDYP
FT                   TPSTNPNIDKITIQHLLNHHAGLTNINKNGDKKDPMFSYSGSTFTGLINWTLSNYPLAS
FT                   NPGQKKQYSNFGYSLLGRVIEKATNADYDSYVKNKILNPAGAKGMVIGRDKKNQQLRNE
FT                   ATYYGGGAYSSVKPQRFDSHGGWIATPIDLLRFMRHNNDHGSSHYGLMDGTAAVYKKNY
FT                   NSNFGYAAATNSRKDPAVLNSLMQDIVNSTSSWPSVNMF"
     atgattcatt cagctcttga tctcaacaac atctttctaa aaatcaacca gaaagcaaaa        60
     gacggcatca aaaaagccac aacaattagc gcaattgcgg ccacaggaat ggtgctgacc       120
     acagcgttgc catcctccgc cagcgaatgg actgcgcggc atggcctgtc aagttctagt       180
     tatcagcaga ctttcaacaa ctacaccaag aaaggctatt gcctaaagtc aatttcaggc       240
     tatcaacaag cagggaaggc aaattacgct gcaatttgga gcaaaaacga gtgcaagcca       300
     tttattgctc gtcacggatt gagtccacaa aaatatcaag ccgcatttaa cgctttcaac       360
     aaaaaagggt atcgcttgac atacatcaat ggatatgaaa ttggaggcaa gccattctat       420
     gcagcgattt gggaaaaaac ctctggccct gcttacgaag cacggcacgg cctcactgaa       480
     aagcaatacc aaagccaagt cacttctatg tctggcaaag gatacggaat aaagcatgtt       540
     agcgcattta gtctaaaagg atctcctaga tttgctgtca tattcgaaaa gaatatgccc       600
     acatggaaag ctcggcacgg acttacacac tctcaatacc agaaagaatt taacaagtca       660
     gccaaagaag gctatcgcct gaaagtagtc accggctatc gcaaagggaa tagcgatcgc       720
     tatgctgctg tgtggaccaa agaaggcggg caatattatc aagcacgcca tagcattcca       780
     accaaaaact accagcatat cttcgacaac tatcgatatc agagttacga accaaaatac       840
     atcgaagcat tcaactcagc gagtggagtc aagttcaatg gagtctggga aaacaagaaa       900
     tttgcaagca aaagcctacg atcaatagaa aggaaagttg gtcaatacat gcgtgataac       960
     aacatcaaag gcctgtcgat agccattagc aaaaacaata aacttgtgta cgcccgtggt      1020
     ttcggcaaag cagacatcac aaagggaatt gcagtggggc caaagcatcg ctttcgcatt      1080
     gccagcgttt caaagcttgt aactcaagcg gcaatcaaga aactcttgaa agaaacatct      1140
     ctaaactcaa actctaaagt atttggcaaa aacagtattc ttggagacga ctacccaacg      1200
     ccttcaacca acccaaacat cgataaaatc acaattcagc atctactgaa ccatcacgca      1260
     ggattgacaa atatcaacaa gaatggagac aaaaaagatc caatgttttc ttactctggg      1320
     tctacgttta ccggcctaat caattggaca ttaagcaatt accctttagc ctcaaaccct      1380
     ggacaaaaaa agcagtattc taactttggg tactctttac tggggcgagt gattgagaaa      1440
     gcaaccaatg cagactacga ttcttacgtg aaaaacaaga tcctgaatcc tgcaggtgcc      1500
     aaaggcatgg ttatcgggcg agacaaaaag aaccaacaac tgcgcaatga agctacatac      1560
     tatggaggag gagcttattc aagcgtcaag cctcaacggt ttgattctca tggtggatgg      1620
     atagccacac ctattgatct acttcgtttc atgagacaca acaatgacca cgggagtagc      1680
     cattacggcc ttatggacgg cacagcagca gtgtacaaga agaattacaa ctcaaatttt      1740
     ggctatgctg cagcaactaa cagccgcaaa gaccctgcag ttcttaacag tttaatgcaa      1800
     gacatcgtca actcaacctc cagctggcct agcgttaata tgttttaa                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page