(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE352

CP000435.PE352       Location/Qualifiers
FT   CDS_pept        complement(363124..363600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0359"
FT                   /product="Cupin superfamily (DUF985) superfamily"
FT                   /note="identified by match to protein family HMM PF06172"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46254"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID81"
FT                   /protein_id="ABI46254.1"
FT                   /translation="MNKRNPSEVVEKLVEEWKLQPHPEGGWYRELHRSSVLVIRPDQQQ
FT                   RCAISTILYLLDSGSLSRWHRVSHADEVWTHLQGAPLSLWCLKPKADQATREVLSMHNP
FT                   VQVIPADHWQAAKAEGPYSLVSCCVGPGFSFEDFTMLRDLPESERPTAALPDLI"
     atgaacaaac gcaacccttc agaagtcgtt gagaagctgg tagaggaatg gaagctgcaa        60
     ccccatccag agggcgggtg gtatcgcgag ctgcatcgaa gctctgtgct tgtgattcga       120
     cctgatcagc aacagcgctg tgccatcagc acaatcttgt atctcttgga ttcaggatcg       180
     ctgagtcggt ggcacagggt gagccatgcc gatgaggtgt ggacccatct acaaggagca       240
     cccctaagtc tgtggtgcct caagcccaag gctgatcagg ccactcgaga ggtgttgtcg       300
     atgcataacc ctgttcaggt cattccagcg gatcactggc aggccgccaa agccgaaggt       360
     ccttacagcc tggtgagttg ttgtgttgga cctggattca gctttgaaga tttcaccatg       420
     ctcagagatc ttccagaaag cgaacgtcca acggcagcgc ttcctgatct gatctga          477
//

If you have problems or comments...

PBIL Back to PBIL home page