(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE354

CP000435.PE354       Location/Qualifiers
FT   CDS_pept        365053..366873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0361"
FT                   /product="Glycosidase"
FT                   /EC_number="2.4.1.7"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45857"
FT                   /db_xref="GOA:Q0ID79"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID79"
FT                   /protein_id="ABI45857.1"
FT                   /translation="MRQQFAELCSIPDALGKGTVSKLLMAHKWLPSLLTELYEHHSSED
FT                   LNLLSSQLLHSERSASEKAVSESLDVGSADATATGARWDSSSCVLIAYADTVSADDQPG
FT                   LRCLQALLHEHFNGLSSVVHVLPFLRSTSDGGFAVASHEEIEQRFGDWNDLAALAEGRQ
FT                   LMADLVLNHISASHPWVRAFLKGEQPGARCVLAAAPNPCWDNVVRPRSSALFTTLATDR
FT                   GPETVWTTFGPDQVDVNWREPEVLLGFTRLLDLFCSYGVQWLRLDAVGFVWKEPLSDCI
FT                   HQPQAHRLVEVLRLLLESRCPQGVVVTETNVPEQENLSYLTTGSEAHLAYNFPLPPLVL
FT                   EACLSRRADLLNNWLARWPQLPQGTGLLNFTACHDGIGLRPLEGLMESDRLLQLLKQCE
FT                   QRGGLVSHRRLADGLEVPYEINISWWSAMAAPGRDPSHHQRARFLLTQLLLLTLPGVPA
FT                   FYLPALLATPNDNARFLLSGHRRDLNRPQFQLDRLERLLVDVESDTPQVVASLQQAMAV
FT                   RRGQAALDPFAPMKVLSEGRSDLVILQRGEGASTLFAIHNFSDVRLSFPLSTLANATGC
FT                   VWHDVLKGHSLVAGQTALDLEPFAVHWLTR"
     atgcgacaac aatttgcgga gctctgttcc atacctgatg cacttggcaa aggcacggtg        60
     tcgaagctgt taatggcgca taagtggttg ccatcgcttc tgacggagct ctatgaacac       120
     cattcttcgg aggatctcaa tctgctgtcg tcgcaattgc tgcattccga gcggtccgct       180
     tcggagaagg ccgtttcaga gtcgcttgat gttgggagtg cggacgcaac ggcaacgggt       240
     gcgcgttggg attcctcgag ttgtgtgttg attgcctatg ccgatacggt gagtgccgat       300
     gatcagcctg ggctccgttg tttgcaggcc cttcttcacg agcatttcaa cgggctctca       360
     tccgtcgtgc atgtgttgcc cttcttgcgc tcaaccagtg atggcggttt tgccgttgcc       420
     agtcatgagg agattgaaca acgcttcggt gattggaatg acttggccgc gttagctgaa       480
     ggccgccagt tgatggctga tttggttctc aatcacattt cagcgtctca cccttgggtg       540
     cgagctttcc tgaagggaga gcaacctgga gcgcgatgtg tgttggctgc tgctcccaac       600
     ccttgttggg acaatgtggt gcgcccgcgt agctcagccc tcttcaccac attggcaaca       660
     gatcggggcc cagaaacggt ctggaccacg ttcggacccg atcaagttga tgtgaactgg       720
     cgagagcctg aagtgttgtt ggggttcaca cgactgctcg atcttttttg cagttatggc       780
     gtccaatggt tgcgccttga tgccgtgggg tttgtttgga aagagccttt gagtgattgc       840
     atccatcagc ctcaggctca tcggttggtg gaagtgttgc gtcttctctt ggagtcgcga       900
     tgtcctcagg gagtggtggt gacagagacg aatgtcccgg agcaggaaaa tctgtcttat       960
     ttgaccacgg gttctgaagc gcacctcgcc tacaacttcc cattacctcc gctggtcctc      1020
     gaggcatgtc tcagtcgtcg tgctgatctg ctgaacaact ggctggcgcg ttggcctcag      1080
     ctccctcagg gaacaggcct gctcaatttc acggcatgtc atgacgggat tggtttgcgg      1140
     ccactcgaag ggctgatgga atccgatcgc ttgctccagt tgctgaagca atgcgagcag      1200
     aggggtggct tggtgagtca ccggcgcttg gcggatggac tggaggttcc ttatgaaatc      1260
     aacatcagct ggtggagtgc catggcggct ccagggaggg atccatcaca ccatcaacga      1320
     gcgcgttttt tgttgacgca attgttgctg ttgacgttgc ccggtgtgcc tgcgttttat      1380
     ttgccggcgt tattggcaac tcctaatgac aatgccagat ttctcctcag cggtcatcgg      1440
     cgcgatctca accgtcctca atttcaactc gaccgcctag agcgtttgtt ggttgatgtt      1500
     gaaagcgata cccctcaggt ggtggcgtca ctgcaacaag cgatggctgt ccgtcgtggc      1560
     caggcggcgc tagatccctt cgccccaatg aaggtcctga gcgaagggcg ctctgatctg      1620
     gtgattctgc agaggggtga aggggcaagc actctgtttg cgattcacaa tttcagtgat      1680
     gttcgcctca gtttcccttt aagcaccctt gctaacgcca cagggtgtgt ttggcatgac      1740
     gttttgaaag gacattctct tgttgccggc caaacggctc tcgatcttga gccgtttgct      1800
     gtgcattggt taactcgatg a                                                1821
//

If you have problems or comments...

PBIL Back to PBIL home page