(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE355

CP000435.PE355       Location/Qualifiers
FT   CDS_pept        366858..367679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0362"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase homolog"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM TIGR01484;
FT                   match to protein family HMM TIGR01486; match to protein
FT                   family HMM TIGR02461"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45573"
FT                   /db_xref="GOA:Q0ID78"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID78"
FT                   /protein_id="ABI45573.1"
FT                   /translation="MVNSMTKTDALCSIPWWVVTDLDGTLMDHDYNWEPAREAIRGLQL
FT                   KGIPVIPCTSKTAVEVKHFRAAVGLKDPYIVENGGAIHGETSDGEPWELVLGCPVAELR
FT                   PVLLELEQLLSEPLQPIDALSDQEAFDLLGLQGKALQLACTRCWSLPFVPPSASARQRL
FT                   PDLANRLGFAVVQGNRMGHLLGVDVSKGRALEVLKQRRAGSPVRVLALGDSPNDQPLLD
FT                   AGDLSVVVPGANGPHPVFAEAIAQGRYQLASACHAQGWAEAVFQYILNEQS"
     ttggttaact cgatgactaa aacagatgct ctgtgctcaa tcccctggtg ggtcgtcacc        60
     gatctcgatg ggaccctgat ggaccatgac tacaactggg agccggcacg ggaggcgatt       120
     cgtggcttgc agctaaaggg aattccggtg attccctgta cgagcaaaac ggcggtggag       180
     gtgaaacatt tcagggctgc cgttgggttg aaggacccgt acatcgttga aaacggaggg       240
     gctattcatg gggaaaccag tgatggtgag ccatgggagc ttgtattggg atgccctgtc       300
     gctgagcttc gcccggtttt gcttgagctt gagcagttgc tcagtgaacc attgcaacct       360
     attgacgcac tttcggatca agaagctttc gaccttcttg ggttgcaggg caaagcgctg       420
     cagttggcgt gtacgagatg ttggagtttg ccctttgttc ccccttccgc atcagcgcgg       480
     caacggttgc cagatctcgc caaccggctt ggattcgctg tggttcaggg caaccgtatg       540
     ggtcacctac tcggagtcga tgtcagcaag ggtcgagcgc ttgaggtttt gaagcagcgc       600
     cgtgctggct ctcccgtgcg ggtgctcgca ttgggtgact ctcccaatga ccagcccctt       660
     cttgatgctg gtgatctctc cgttgtggtg ccgggtgcga atggtcccca tccggtcttt       720
     gctgaagcca ttgctcaagg ccgctatcag ttggcttctg cttgccatgc gcagggctgg       780
     gcagaggcgg tctttcagta cattctcaat gaacagagct ga                          822
//

If you have problems or comments...

PBIL Back to PBIL home page