(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE356

CP000435.PE356       Location/Qualifiers
FT   CDS_pept        367769..368191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0363"
FT                   /product="Predicted redox protein"
FT                   /note="identified by match to protein family HMM PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45825"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID77"
FT                   /protein_id="ABI45825.1"
FT                   /translation="MTAIQCRYTGDLHCTAQHGPSGSVLNTDAPTDHDGLGESFSPTDL
FT                   LATALGTCILTIMGLAARRRGWDLVDASVIVEKTMTTEGPRRIESLQAQISLPVALSQE
FT                   QKTLLKRVANDCPVKRNLDTSITIDLIWNDASSTAL"
     atgacagcga ttcaatgccg atatacaggt gacttgcact gcacggctca gcacggaccc        60
     tcggggtccg tcttgaacac cgatgcgcca actgatcatg acggccttgg cgaaagcttt       120
     tcgccgactg acctactggc gacagccctt ggaacctgca tcttgaccat catgggtctc       180
     gccgcacggc gccgcggctg ggacctcgtt gacgccagcg tcatcgttga aaaaacaatg       240
     acaacagaag gaccgcgccg cattgaaagc cttcaagctc agatcagcct ccctgttgcc       300
     cttagtcagg aacagaagac cttgctgaag cgtgtcgcga atgattgccc cgttaaacga       360
     aacctcgaca cttcaatcac gattgatttg atctggaacg atgcaagttc tacggctctc       420
     tag                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page