(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE358

CP000435.PE358       Location/Qualifiers
FT   CDS_pept        369965..370219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0365"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46703"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID75"
FT                   /protein_id="ABI46703.1"
FT                   /translation="MSAVKKPMALGIDSSRMGSDQIVRDSDPSNEAFDDGSDVDGVVWP
FT                   EWLRSAYSINSVQINTFLNLIDSQPVMAGDQLSLAHEGG"
     gtgagtgccg tgaaaaagcc catggctctt gggattgatt cttccagaat gggctctgat        60
     cagattgttc gtgactctga tccatcaaat gaagcatttg atgatggcag cgatgtcgat       120
     ggcgtggttt ggcctgaatg gctcagatcc gcatactcaa taaactcagt acaaatcaat       180
     accttcctta atctcattga ttcacagccc gttatggcag gtgaccagtt aagtcttgct       240
     catgaaggtg gatga                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page