(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE359

CP000435.PE359       Location/Qualifiers
FT   CDS_pept        complement(370193..371431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0366"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47517"
FT                   /db_xref="GOA:Q0ID74"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID74"
FT                   /protein_id="ABI47517.1"
FT                   /translation="MRDVAGGAFITPERERYAYFSAPYRNEDIILISRRSESSAIAMLR
FT                   PDVFKQSFPSSKLRLGVVSGYYYGDAIDRFLKDQSNQNRWTSVKTDIENLQNLVNGKVD
FT                   LVAIDRLVGSTLIWEESLSRDLIAGKDHIFSGPIVALFSRRTTSPALVSAFDQAMQKLK
FT                   GDGRYNQIVRDYLFPSLLAMTAGQPWFFILETIGTAAFAFSGILLARRDRFSLFGALVL
FT                   ASLPAFGGGIIRDLIANRDQPAVLQSTHNMMIVIALVLISHLIARLTNLRGLPSQLSKF
FT                   HFGEKAVQVLDALGLSAFTVVGVIVAVEEKCNPLLLWGPIFSAMTGAGGAILRDVIRAD
FT                   ASHPTLRHDFYAELSFFWGLMLSIFISMYANSNNLHTLPMNLAVLFTTLGCLLSRLVVM
FT                   QRGIKSSTFMSKT"
     atgcgagatg tagctggagg agcttttatc acgccagagc gtgagcgcta tgcctacttt        60
     tcagcccctt atcgaaacga agacatcatt ttgatcagtc gacgatcgga atcgagcgcg       120
     atcgcaatgc ttcggcctga tgtctttaag caatcattcc cttcaagcaa gcttcggcta       180
     ggtgttgtat ctgggtatta ctacggagat gccatcgata gattcctcaa ggatcaatcc       240
     aatcaaaatc gatggacatc agtcaaaaca gacatcgaaa atctacagaa tctggtgaac       300
     gggaaggttg atttagtcgc tatcgatcgc ctcgtgggga gcactttgat ttgggaagaa       360
     tctctcagtc gagatctaat tgccggcaaa gatcacatct tctcaggtcc aattgtcgcc       420
     cttttcagtc gtcgcaccac atcaccagcg ctcgtttccg catttgatca agcgatgcaa       480
     aagcttaaag gcgatggacg ttacaaccaa atcgttcgcg attatctctt cccttcctta       540
     ttggccatga ctgcaggcca gccatggttt ttcatcctag aaacgattgg tacggcagca       600
     tttgcttttt ccgggatttt gctggcgcga cgtgatcgat tcagcctatt tggcgcactc       660
     gtgcttgcaa gtcttcccgc ttttggtggc ggcatcatca gggatttgat tgcaaatcga       720
     gatcaaccag cagtccttca atccactcac aacatgatga ttgtgattgc actcgtgctg       780
     atcagtcact tgatagcaag gcttacgaac ctacgcggtt tgccaagcca gctaagcaaa       840
     tttcattttg gagaaaaagc cgttcaagtt ttggatgccc tcggcttatc agctttcacc       900
     gtggttggag tcatcgtggc cgttgaggaa aaatgcaatc ccttgctcct ctgggggcca       960
     atcttcagcg ccatgactgg agcaggcgga gccattcttc gtgatgtaat tcgagccgat      1020
     gcaagccatc cgacccttcg gcacgacttc tacgccgaac tctcgttctt ctggggatta      1080
     atgctatcga tattcatctc aatgtacgca aattccaaca atttgcatac attgccaatg      1140
     aatcttgccg tactattcac gactctcgga tgcttattgt ccaggctagt ggtgatgcaa      1200
     cgcggcatca aatcatccac cttcatgagc aagacttaa                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page