(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE362

CP000435.PE362       Location/Qualifiers
FT   CDS_pept        373103..374707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0369"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45492"
FT                   /db_xref="GOA:Q0ID71"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID71"
FT                   /protein_id="ABI45492.1"
FT                   /translation="MSNAVSIKGSRAAGERVLFVRLPCNPIFPIGPIYLADHLHKCFPD
FT                   LPQRILDLAALPVLDVEGVLLNVVDQFRPTLLVFSWRDIQIYAPVDGRGGNPLQNSFEV
FT                   FYARNPLKRVKGALGGLRLMTSHYGELHRNQKLVRHGLKRARRHSPEARAVLGGGAVSV
FT                   FYEQLGRSLPKGTIISIGEGEPLLEKLLAQQPLDGERCFVVGEAPRPGLIHEQPESRPK
FT                   TACDYNYISSIWPQLDWYLEGGDFYVGVQTKRGCPHNCCYCVYTVVEGKQVRVNPVQEV
FT                   VAEMRQLYDRGVRGFWFTDAQFIPARKYIEDAKELLRAIKAEGLTGIRWAAYIRADNLD
FT                   PELAQLMVETGMSYFEIGITSGSQELVRKMRMGYNLRTVLDSCRMLAEAGFHDHVSVNY
FT                   SFNVIDERPETIRQTVAYHRELEAIFGEDRVEPAIFFIGLQPHTHLEQYGFDQGLIKPG
FT                   YNPMSMMPWTARKLLWNPEPMGSTFGRVCLEAFDRDPGRFGKTVMELLERDYGVAPLDQ
FT                   ALRAPVQGRAALAKAVS"
     atgagcaatg cagtgtcgat aaagggttca agggcagcag gcgaaagggt cctgtttgtg        60
     cgtttgccat gcaatccgat ctttccgatc ggcccgattt atctggctga tcacttgcac       120
     aagtgtttcc cggacttgcc ccagcgcatt cttgatttgg ccgcacttcc tgtcttggat       180
     gttgagggcg ttttgctcaa tgtggtggat cagtttcggc ccacgctgct ggtgttctcc       240
     tggagagaca ttcagattta tgcccctgtg gatggccggg gtggaaaccc acttcaaaac       300
     tcatttgaag tgttctacgc acgcaaccct ctgaagcgtg tcaaaggggc cttgggtgga       360
     ttgcgcctaa tgaccagtca ttacggagag ctgcatcgca atcagaaatt ggtgcgccat       420
     ggtttgaaaa gggcgcgtcg ccatagtccc gaggcccgtg ctgtcctcgg aggaggcgca       480
     gtcagcgttt tctatgaaca gctgggccga tccttgccca agggcacgat catctcaatt       540
     ggcgagggtg agccccttct cgaaaagctt ctggcccagc aaccgctaga tggagagcga       600
     tgcttcgttg tgggagaggc tcctcgccct ggtttgatcc acgagcaacc cgagagcagg       660
     ccaaagacag cgtgtgatta caactacatc tcttcaatct ggccacagct ggattggtac       720
     ttggaaggtg gtgactttta cgtaggcgtt cagaccaaac gaggttgccc tcataactgt       780
     tgttattgcg tctacaccgt tgtggaaggc aagcaagttc gggtcaatcc tgtgcaggaa       840
     gttgtcgctg agatgcggca gctttatgac cggggagtgc gtggtttttg gttcacagat       900
     gctcagttca tccccgctcg caaatacatc gaggatgcaa aagagctgtt gcgtgcgatc       960
     aaggctgaag gcctaactgg gattcgatgg gcggcctaca tccgagccga caacttggac      1020
     cctgagttgg ctcagttgat ggttgagacg ggcatgagtt atttcgaaat tgggattacg      1080
     tcaggttccc aggagctcgt gcgcaaaatg cgtatggggt acaacctgcg cactgtgttg      1140
     gacagttgca ggatgctggc cgaggctggc ttccatgatc acgtctcggt gaactactcc      1200
     ttcaacgtga ttgatgaaag gccggaaacg attcggcaaa ccgtggcgta tcaccgtgaa      1260
     cttgaagcga ttttcggtga agaccgggtc gagcccgcta ttttttttat tggcttgcaa      1320
     ccccacacgc atctcgagca atacggcttc gatcaaggcc tgattaagcc tgggtacaac      1380
     ccgatgagca tgatgccttg gacggcacgc aaactcctct ggaatcctga gccgatgggc      1440
     agcaccttcg gtcgggtttg ccttgaagcg tttgatcgcg atcctggacg ttttggcaaa      1500
     acggtgatgg aacttcttga gagggactac ggagttgcgc ccctcgacca agctcttcgt      1560
     gcccctgttc agggacgcgc cgctttagcc aaggcagtca gctga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page