(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE363

CP000435.PE363       Location/Qualifiers
FT   CDS_pept        complement(374671..375501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0370"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46301"
FT                   /db_xref="GOA:Q0ID70"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID70"
FT                   /protein_id="ABI46301.1"
FT                   /translation="MRTSWFTLKPRWIPTITLIPALYALGWLLLQPISLLVPGRSIPSQ
FT                   DLIGTGISVLLFLLILPSWTRTRWETRHPWRQLGLKAAARGPSSRRSLLNGLGWAASLL
FT                   LIICLISLGGQWGQWLGDFSAAKLINALLLCFGVGLIEELLFRGWLLGELNLLIGAKRA
FT                   VPAQAVIFSLVHTRFNLGFWPMLSLLIGLFLLGMALATRRQLDGGSLWGCIGLHGGLVG
FT                   GWFALQSGLIQWSPESPFWLTGPGDNPLGGMVGIACFAALLSFQLTALAKAARP"
     ttgaggacat cctggttcac gctgaaacca cggtggatcc ccaccattac tctcattcct        60
     gccctttacg cactgggttg gttgctgttg caacccatca gccttctggt cccaggacgg       120
     tcgatccctt ctcaagacct gatcggcaca ggcatcagtg tgttgttgtt tctgctgatc       180
     ctgccgagct ggacgcggac ccgctgggaa acgcgtcacc catggagaca acttggactg       240
     aaggcggcag cgcgtgggcc gagcagtcgc cgctctcttc tgaacggcct gggatgggcc       300
     gcctcactgt tactgatcat ctgtttgatc agcttgggag gtcaatgggg gcaatggctg       360
     ggagatttca gtgctgccaa gctgatcaac gccctactgc tttgctttgg cgttggcctg       420
     atcgaagagc tgctattcag aggctggctt ttgggagagc tcaatctgct cattggtgcg       480
     aagcgagctg ttcccgcaca agcggtgatt ttcagcctgg tgcacacccg attcaatttg       540
     ggattttggc cgatgctgag cctattaatc ggtttattcc tactagggat ggcccttgcg       600
     acgcgtcggc aactcgacgg tggctcactt tggggatgta tcgggctgca tggcggattg       660
     gttggcggct ggtttgcgct tcagtccggc ttaattcagt ggtctcctga atctccgttt       720
     tggctaacag gccctggaga caatccccta ggaggcatgg tggggatagc ctgcttcgcg       780
     gctttactca gctttcagct gactgccttg gctaaagcgg cgcgtccctg a                831
//

If you have problems or comments...

PBIL Back to PBIL home page