(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE369

CP000435.PE369       Location/Qualifiers
FT   CDS_pept        complement(382722..383297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0376"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45437"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID64"
FT                   /protein_id="ABI45437.1"
FT                   /translation="MPRQDTVMPLAFRASQHLDLPIADESERLRAYLHEHDRVVKALLD
FT                   PNQLTAFAPGRYRYTVTTLHVFQLQVKPVVSLEVDEVSGQLRIRALDADLEGLGLVDDF
FT                   QLSLEALLEATPRGLQGEAMLSVEVSQPPLLRLIPKRVLESTGESILNGILLTIKGRVG
FT                   RQLVADFQSWAKDLDTPPPSKSALHSGK"
     atgccgcgtc aggacacggt catgcccctg gcctttcgag ccagtcagca tcttgatcta        60
     cccatcgcag atgagtcaga acgtctgcgg gcttatttgc atgagcacga ccgcgtggtc       120
     aaagcattgc tcgaccccaa ccagctcaca gcctttgcac cgggtcgcta ccgctacacc       180
     gtgacaacgc tgcatgtctt ccagctgcag gtaaagccag tggtgtctct tgaagttgat       240
     gaagtgagcg gacaactgcg tatccgtgca ctcgatgcgg acctcgaggg cttggggtta       300
     gtggatgatt ttcaactgag ccttgaagcc ttgcttgagg cgactccaag gggactgcaa       360
     ggggaagcga tgctgagcgt ggaagtgagc cagcctccac tcctacgcct gattcccaag       420
     cgtgtgttgg agagcaccgg ggaatccatc ctgaatggaa ttctgctcac gatcaaaggc       480
     agagtcggac gtcagttagt ggctgatttc caatcttggg ccaaggattt agacacccct       540
     ccccccagca agtccgccct acacagtggc aaatag                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page