(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE43

CP000435.PE43        Location/Qualifiers
FT   CDS_pept        45259..45486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46157"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE40"
FT                   /protein_id="ABI46157.1"
FT                   /translation="MLNSVLDRTSTMVQSAPNQKQEHLAKAGVFFQKAQSAAEAGDVSS
FT                   SGSFILKALEQERRAGTVGPQVMQLIKPRS"
     gtgttgaatt cggtcctcga tagaacttca acgatggtgc aatctgctcc caatcaaaaa        60
     caggagcatc ttgctaaagc aggtgtgttt tttcagaaag cacaatctgc agctgaagcg       120
     ggcgatgtct cgtcttcagg atctttcatt ttgaaagcac ttgaacagga acggcgcgca       180
     ggcaccgttg gtcctcaggt gatgcaattg attaaaccaa gatcttga                    228
//

If you have problems or comments...

PBIL Back to PBIL home page