(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE432

CP000435.PE432       Location/Qualifiers
FT   CDS_pept        439589..440353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0442"
FT                   /product="HAD hydrolase homolog"
FT                   /note="identified by match to protein family HMM PF00702"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45176"
FT                   /db_xref="GOA:Q0ID01"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ID01"
FT                   /protein_id="ABI45176.1"
FT                   /translation="MSLQPLLVFDFDGVILDGMDEYWSSSRAACRSLLQGVLLPEQTPT
FT                   SFRHLRPWVHHGWEMVLIAALLQESDGPLQCLGVDAFAADYDQQLRAGLDRFGWQSSQL
FT                   QDSLERVRRQAVSDDRAGWVALHRPFDGVTERLLRLEDEGVAWSVLTTKGRDFTAELLE
FT                   AFQLRPIRLDGRESGPKPEVLLRLCREWVLKGFVEDRRATLEAVLETPGLEDMNCFLAD
FT                   WGYLRPADREGLPQGIDLLSTSKFASPLAIWL"
     gtgtcgttgc aacctctcct cgttttcgat ttcgacgggg tgatcctcga cggaatggat        60
     gaatactggt cgagttctcg agcagcttgt cgatccctgc ttcagggggt gttattgcct       120
     gagcaaacac cgaccagctt tcgtcacttg cgtccctggg ttcatcacgg ctgggagatg       180
     gtcctgatcg ctgcattgct tcaagagtca gacggaccgt tgcagtgtct tggtgttgat       240
     gctttcgccg ctgactatga ccagcagctt cgcgctggtc tcgatcggtt tggatggcaa       300
     tcgtcgcagc tacaagattc tctggagcgg gtccgccgtc aggccgtgtc tgacgatcgt       360
     gccggttggg tggcattgca tcggccattt gacggggtga ctgagcgttt gttgcgcttg       420
     gaggatgagg gtgtggcttg gtctgtgctc acaacaaaag ggcgtgattt cacggctgag       480
     ttgcttgagg cttttcagct tcgacccata cgcctcgatg gcagagagtc cggcccaaag       540
     cctgaggtgt tacttcgctt gtgccgcgaa tgggtgctga agggttttgt ggaagatcgg       600
     cgggccactc ttgaagctgt gttggagaca cctggacttg aagatatgaa ctgctttttg       660
     gccgattggg gctatctgcg tccggcggac cgagagggtt tgcctcaagg gattgatttg       720
     ctgtcgacca gcaaatttgc atcccccttg gcgatctggc tctga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page