(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE435

CP000435.PE435       Location/Qualifiers
FT   CDS_pept        complement(442093..442332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46730"
FT                   /db_xref="GOA:Q0ICZ8"
FT                   /db_xref="InterPro:IPR021262"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ8"
FT                   /protein_id="ABI46730.1"
FT                   /translation="MGEARRRNSQGLPPKQRKPDPKDSERIVAWLPLTRSQSQRFVALT
FT                   TRGAWIGIGALVLFWIVVRFIGPAAGWWTLADTP"
     atgggagaag ctcgacgtcg caacagccag ggactacctc ccaagcaacg caaaccagac        60
     ccgaaggaca gcgagcgaat cgttgcttgg ctgccgttaa ccaggagcca atcccagcga       120
     tttgttgcct taactacccg tggagcctgg atcggcatcg gagccttggt gctgttttgg       180
     atcgtggtgc gcttcattgg accggctgcc ggttggtgga cgctggccga cacgccctaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page