(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE439

CP000435.PE439       Location/Qualifiers
FT   CDS_pept        446367..447239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0449"
FT                   /product="fructosamine kinase family protein"
FT                   /note="identified by match to protein family HMM PF01636;
FT                   match to protein family HMM PF03881"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45638"
FT                   /db_xref="GOA:Q0ICZ4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ4"
FT                   /protein_id="ABI45638.1"
FT                   /translation="MRTQLLEALQTDFCERQGCQCKTLEPVGSASTWRADLSDGRSLFL
FT                   KLASPVMLNVEARGLRSLQQWADPTLLLIPDPLGIVPVGELAALILPWLDTGRGNQYDL
FT                   GRGLALLHRTSADAGKERFGWDEEGFIGLGPQPAGWLTAWGDAFVTLRLTPQLQLARNW
FT                   GLALDQLEPLLAATRIWLDQHQPLPCLVHGDLWGGNASVLADGRGALIDPACWWADREV
FT                   DLAMTRLFGGFSARFYEGYQKEWPLDPNYCDRIDVYNLYHLLNHANLFGGGYKKKCLTA
FT                   INAMRSMLL"
     atgcgaacgc aattgcttga ggcgttgcag accgattttt gtgagcggca gggctgccag        60
     tgcaagaccc tcgagcctgt tggcagtgcc tccacttggc gtgctgactt gtcagatgga       120
     agatcgttat ttcttaagct ggcatcgcca gtcatgctca atgtggaagc ccgggggctc       180
     cgctccctac agcaatgggc tgaccccacg cttctgttga ttcctgatcc gcttgggatt       240
     gtcccggtgg gagagcttgc agctttgatc ttgccctggc tcgatactgg ccgaggcaat       300
     caatacgacc ttggtcgagg cttggccctc cttcatcgaa cctctgctga tgctgggaag       360
     gagcgatttg gttgggatga agaaggattt attggattgg gtccgcaacc agctggctgg       420
     ttgacggctt ggggtgatgc ttttgtgacg ttgaggctta ccccccagct tcaactggca       480
     agaaactggg gcttggccct ggatcaactc gaacctttat tggcagcaac acggatttgg       540
     ttagatcaac atcagcccct gccctgtctc gtgcatggcg acctatgggg cggaaacgcc       600
     tcagtgctcg ccgatggacg tggcgcactg atcgatccag cctgttggtg ggctgatcgg       660
     gaggtggatc tggcaatgac ccgcttgttt ggaggattca gtgcacgttt ttatgagggc       720
     tatcaaaaag agtggccctt agatcccaac tattgcgatc gaattgatgt ttacaacctc       780
     tatcacttgc ttaatcacgc caacctgttt ggtggtgggt acaaaaaaaa atgcctcaca       840
     gcaatcaatg ccatgaggtc aatgttgttg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page