(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE440

CP000435.PE440       Location/Qualifiers
FT   CDS_pept        complement(447264..447650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0450"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46451"
FT                   /db_xref="GOA:Q0ICZ3"
FT                   /db_xref="InterPro:IPR025564"
FT                   /db_xref="InterPro:IPR033344"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ3"
FT                   /protein_id="ABI46451.1"
FT                   /translation="MSEESTTPASESTWTANTSEPSTSAETTNFSERYSEILGKVNETL
FT                   DKVDWSQAGRIGKVVGIFAAVIVAQILIKGILDTINLLPVVPGLLELLGVVVVGQWSWK
FT                   NLTTSEKRSALVNRVQTIRSEYLG"
     atgagcgagg agtccaccac ccctgcgagt gagtcaactt ggaccgctaa caccagcgaa        60
     ccatccacca gcgcagagac cactaacttt tctgagcgct acagcgagat ccttgggaaa       120
     gtcaacgaga ccttagacaa ggtggattgg agccaggccg gtcgtatcgg aaaagttgtt       180
     ggaatttttg cagctgtcat cgttgcccaa attctgatta aaggcattct cgataccatc       240
     aatcttcttc ctgtcgtacc aggactgctc gagcttctcg gcgttgtggt ggttggccaa       300
     tggagctgga aaaatctcac taccagtgaa aagcgcagcg ctttggtgaa tcgcgttcag       360
     accattcgta gcgaatacct gggctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page