(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE441

CP000435.PE441       Location/Qualifiers
FT   CDS_pept        447674..448285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46891"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICZ2"
FT                   /protein_id="ABI46891.1"
FT                   /translation="MAEIIGLSSQAPSQLIIGAECLMVLRQDLLAPAPAEGCALLLGQG
FT                   HGAPDSASDDWSVQLIWPCRNMVEQQVHDRFELDPREQIAAQRWARSRSLKVLGSAHSH
FT                   PTASVVPSRRDRLWAVSSGLMLIMGNNHAVAAWWLEVEAPRCALAEVHPLSIQVMRETS
FT                   LKSFPGELGIRHEGSGGYSSAQWRGEDQICPPHHAPRGGS"
     ttggctgaga ttatcggtct ttcttcacaa gcgccatccc aattgatcat tggtgcggaa        60
     tgtctgatgg ttctccgtca agatcttctt gcgccagcac ctgcagaagg ctgtgctttg       120
     ttgctcgggc aggggcatgg tgctcccgat tccgcttcag acgattggag cgtgcagttg       180
     atctggcctt gccgaaacat ggtggagcag caagtccatg atcgttttga gttggatcct       240
     cgagagcaaa ttgctgcgca acggtgggcg cgctcgcgct cattaaaagt acttggcagt       300
     gcccattccc atccgacagc ttcggttgtg ccgagtcgga gagatcgtct ctgggctgtg       360
     agttctggac tgatgctaat catgggaaat aaccatgcag tagcggcttg gtggctggag       420
     gtggaggctc cccgttgcgc tctcgccgag gtgcatccac tgtcgattca ggtcatgagg       480
     gagacttctc tgaagtcctt cccaggagaa ctgggaattc gccatgaagg aagcgggggg       540
     tactcctcag ctcagtggag aggagaagac cagatatgcc cgccacatca cgctccccga       600
     ggtgggagtt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page