(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE450

CP000435.PE450       Location/Qualifiers
FT   CDS_pept        complement(458240..459385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0461"
FT                   /product="putative glutamate--cysteine ligase"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR02048"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABI47790"
FT                   /db_xref="GOA:Q0ICY3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011792"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICY3"
FT                   /protein_id="ABI47790.1"
FT                   /translation="MIQKLRLKGFEVELFTGRSSGENVGVAELVKQDLTEFCVEPDHRN
FT                   LEYITNPESDYGKLKEALLAPRRRLRTWLAERNLTLLPGSTLTLGDATQFERSNPNDPY
FT                   HDLIEATYGTTVVTASIHINLGISEPADLFAALRLVRCEAALLLALSASSPFLNRQITG
FT                   AHSQRWLQFPLTPKQVPLFRDLEHFVEWTDTQLMEGRMHNVRHLWTSVRPNGPQRPFDL
FT                   NRLELRICDLVTNPDLLLAITALMELRVLMLLREPNQLDPFKASDLSADQLMVLSDTND
FT                   ATAARHSLDAQLRDWRDGRQRLCRNWLRDMINDVMPLAHELELTSYLLPLESVLAEGNQ
FT                   AMRWLKGIENGRSLEEEFRTGILEMEQEEQPIDRSLADALG"
     atgatccaaa agctcagact caaagggttt gaagtggaac tattcaccgg tcgaagcagc        60
     ggtgagaacg ttggtgtagc cgagctggtc aagcaggatc tcactgaatt ttgcgttgag       120
     cccgaccacc gcaatctgga atacatcaca aatcctgaat ccgattacgg aaaactcaaa       180
     gaagcccttc tggccccgcg caggcgccta cggacatggc ttgcagaacg taatctcacc       240
     ttgctcccag gcagcaccct cacgttggga gatgccacgc aatttgaacg atccaatcca       300
     aacgatccat atcacgacct catcgaagcc acttacggca ccactgttgt aacggccagc       360
     attcatatca acctggggat cagtgaaccg gccgatttat ttgccgctct gcgtcttgtg       420
     cgttgtgaag cagccctact gcttgcctta agcgccagtt caccctttct caatcgccag       480
     atcaccggcg cccattcaca acgttggctg caattccctc tcactcctaa acaagttccc       540
     ctctttcgcg atctagagca tttcgtggaa tggactgaca cccagttaat ggaggggcgc       600
     atgcacaacg tgcgccatct ctggacgtcg gtccgtccca atggcccaca acgacccttt       660
     gacctcaacc gactcgagct aaggatctgc gatctagtca ccaatccaga tctgctgctg       720
     gcgattacag ccctgatgga actgcgcgtg ctgatgttgc ttcgggagcc caatcaactc       780
     gaccccttta aggcgagtga cctcagcgcc gatcagctca tggtgctcag cgataccaat       840
     gacgccactg ccgctaggca tagcctcgat gcgcaattgc gtgattggcg tgatggtcgc       900
     caacgtttat gtcgtaactg gctgagggac atgatcaatg acgtgatgcc cttagcgcac       960
     gaacttgaat tgacgtccta cctgctccct ctcgaatccg ttcttgcgga agggaatcaa      1020
     gccatgcgtt ggctcaaagg aattgagaat ggacgcagcc ttgaagagga attccgcact      1080
     ggcatcctcg agatggaaca ggaagaacag ccgatcgatc gatccctggc tgacgctttg      1140
     ggatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page