(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE454

CP000435.PE454       Location/Qualifiers
FT   CDS_pept        complement(462904..464175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0465"
FT                   /product="putative rod shape-determining protein RodA"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02210"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45291"
FT                   /db_xref="GOA:Q0ICX9"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX9"
FT                   /protein_id="ABI45291.1"
FT                   /translation="MKIGPMSREHSPFTLNRRRKGWRLKEPVLWGIPLAMVMVAGLLIA
FT                   STQRQADYADWYHHWITAAVGVVIALVTARLPLLRLKPLLIPIYAITVISLVAVRLIGT
FT                   TALGAQRWISIGGVHVQPSEFAKLSAILLLAAVLDRHPVERPVDLLRPLGIISIPWLLV
FT                   FIQPDLGTSLVFGALLLTMLYWSGMPIEWLVLLLSPLATALLAGLFPWGLAAWIPLTMI
FT                   ISYSSLPWKRVALALVLIVQSAAALVTPWMWMHGLQDYQRDRLVLFLDPAKDPLGGGYH
FT                   LLQSTVGIGSGGLFGMGLLQGQLTKLRFIPEQHTDFIFSALGEETGFLGTILVVVGFAL
FT                   LMGRLLQLAGQSRSDFESLVVIGVATMLMFQVVVNIFMTIGLGPVTGIPLPFMSYGRSA
FT                   MVVNFLALGLCLSVSRRSQRALNR"
     atgaaaattg gcccgatgag tcgtgaacac agcccgttca ccctcaaccg gcgacgcaaa        60
     ggctggcggc tcaaggaacc ggtgttgtgg gggatccccc tcgccatggt catggtggcg       120
     ggcctcttaa tcgcaagcac ccagcgccaa gctgattacg ccgactggta tcaccactgg       180
     atcacggccg ctgtcggagt tgtgatcgct cttgtgacag ccaggctgcc attgctgcgg       240
     ctgaaaccac tgctgattcc gatctacgcc atcactgtga tcagcctggt cgccgttcgc       300
     ctgatcggca ccactgcgct gggcgctcaa cgctggatca gcatcggcgg ggtgcacgtt       360
     caaccgtcgg agttcgcaaa attgtcagcc attctgttgc tggctgcggt gctcgatcgg       420
     caccctgtcg aaagacccgt cgatctgctg cgtccactgg ggattatctc gatcccttgg       480
     ttgctggtgt ttatccagcc cgacctcggc acatcgctcg tctttggagc gctgcttctc       540
     acgatgctct attggtctgg catgccgatt gagtggctcg tgctgctgct ctcacctttg       600
     gctacggcct tgctcgctgg attgttcccc tggggactcg ctgcttggat cccgttaaca       660
     atgatcattt cctactcatc gttgccatgg aaacgggttg cgcttgcact cgtgctgatc       720
     gtgcaatctg ctgcggccct cgtcacccca tggatgtgga tgcacggatt gcaggactat       780
     caacgtgatc gcctggtgct gtttctcgac ccagcgaaag atcccctcgg aggcggctac       840
     cacctgctgc aaagcacagt tggaattggc tctggaggat tgttcgggat ggggctccta       900
     caagggcaac ttacgaaatt gcgttttatt cctgagcagc acaccgactt catcttcagt       960
     gctcttggag aagagactgg attcttagga acgattttgg ttgttgtcgg atttgctctc      1020
     ttgatgggtc gcctgcttca gctggctggg caaagccgtt ctgatttcga atcgctggtg      1080
     gtgattggcg tcgcaaccat gctgatgttt caagttgtcg tgaacatctt catgaccatt      1140
     ggccttggtc ctgtaacggg tatccccctt ccgtttatga gttacggccg aagcgcaatg      1200
     gtcgtgaatt tcttagccct agggctatgt ctttcggtat cgaggcgctc ccaacgggcc      1260
     ctgaaccgat ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page