(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE459

CP000435.PE459       Location/Qualifiers
FT   CDS_pept        complement(467878..468261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0470"
FT                   /product="possible Pex protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45684"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX4"
FT                   /protein_id="ABI45684.1"
FT                   /translation="MLHRRNATQNCLADIEHYFQQPPPLFLDLELAVCWIVDCLLQHDS
FT                   YPSGLLQRLQREHPQLRVSETVLHQAVDFLNQQELLDCYSKRCPSRGRPRRMLHLHEEA
FT                   RAEAERLMEPWHRWLHEHEPMTT"
     atgctccacc gtcgcaacgc cactcaaaac tgcctggccg atatcgaaca ttattttcag        60
     caaccaccgc cactgttctt agatctcgaa cttgcggtgt gctggatcgt ggactgtctt       120
     ctccaacacg acagctaccc ctctggactg ctccagagac ttcaacggga acatccacag       180
     ttgcgcgtct ctgaaaccgt tctgcaccaa gccgttgatt tcctgaatca gcaagaactg       240
     ctcgattgct atagcaagcg ttgcccaagc cgcggccgtc ctcgccgcat gctccatctt       300
     catgaagaag ccagagccga ggctgagcgg ttgatggaac catggcatcg ttggctccac       360
     gaacatgaac ccatgaccac ctag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page