(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE461

CP000435.PE461       Location/Qualifiers
FT   CDS_pept        complement(469068..469337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0472"
FT                   /product="Uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46982"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX2"
FT                   /protein_id="ABI46982.1"
FT                   /translation="MPAIQDHDYLRLCAELATELGISQSSARRRVELAANKTGAKDLTS
FT                   RKEVATTLLADAQNERSKGEHDQGQVLDRLLEAEPLDEKFMVED"
     atgcccgcga ttcaggacca tgactacctc aggctctgcg cggaactggc cacagaacta        60
     ggcatcagcc agtcatcagc acgccgcaga gttgagctcg ccgccaacaa aactggcgcc       120
     aaagatttga catcacgcaa agaagtggcc acaaccctgc tagcagacgc acaaaacgaa       180
     cgatccaagg gcgagcacga tcagggacaa gtcctcgacc gattgctgga agcagagccc       240
     ctggatgaga aattcatggt ggaggattaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page