(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE462

CP000435.PE462       Location/Qualifiers
FT   CDS_pept        complement(469358..470587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45243"
FT                   /db_xref="InterPro:IPR019994"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICX1"
FT                   /protein_id="ABI45243.1"
FT                   /translation="MLLISNGHGEDIIALKIIEALHNQRPQLRLKVLPLVGEGGSFRTA
FT                   TEQGWVQQIGPSAPLPSGGFSNQSLRGLLADVIAGLPLLTWQQWRCLRKHRAQVDAVLA
FT                   VGDLLPLLMAWGSGRPFGFVGTPKSDYTWCSGPGQDLSDNYHALKGSEWDPWEWLLMRN
FT                   KRCHLVFTRDRLTARGLRRHGVRAEAPGNPMMDGLSNASVPASLSRCRRILLLCGSRIP
FT                   EAERNFSRLLLGLAPLPSDRPIAVLVALGSTPGLPALGAELKRQGFRSSPPPSDALQAG
FT                   ACWLKGHVLVLLGTGQLELWAPWAEVGVATAGTATEQLVGLGIPALSLPGKGPQFTQGF
FT                   AKRQSRLLGGAVRPCQSSHELNTRLNQLLEDPSLRLQMGRKGRQRMGPAGGSEAIAKRV
FT                   LIQLPLGHGY"
     ttgctgctga tcagcaatgg tcatggggaa gacatcatcg ccttgaaaat catcgaggcg        60
     cttcacaacc aacgtccgca actaaggctg aaggtgttgc cgctcgttgg ggaaggggga       120
     agcttcagga ccgccacgga acaaggctgg gtacaacaaa tcggcccctc cgctccgctc       180
     ccaagcggcg gttttagcaa tcaaagtctt cggggcctcc tagcggatgt aatcgcaggg       240
     ctacccctgc tcacttggca gcaatggcga tgcctgcgca agcatcgggc tcaggtcgac       300
     gccgttcttg ccgtgggaga ccttctcccc ctcttgatgg cttggggttc gggacggccc       360
     ttcggcttcg tcggcacccc gaaaagcgat tacacctggt gtagcggccc tggacaagac       420
     ctcagcgaca actatcacgc ccttaaggga agcgaatggg atccctggga gtggctgctt       480
     atgcgcaaca aacgctgcca tttggttttc acccgtgacc gtttaacggc tcgagggcta       540
     cgacgacatg gggtccgcgc cgaagcccct ggcaatccga tgatggatgg actgagcaac       600
     gcaagcgttc ctgcaagcct gagtcggtgc aggcgcatcc tgttgctatg cggaagccga       660
     atacccgaag cagagcgcaa cttcagccgt ttacttcttg gtttggcacc gttgcccagc       720
     gaccgaccga ttgccgtgct ggttgcgctt ggcagcactc ctggcctgcc agcccttgga       780
     gcagaactca agcgccaggg gtttcgatcc agtccgccac ccagtgatgc tttgcaagca       840
     ggagcctgct ggctcaaggg acatgtcctt gtcctattgg gaactggtca gcttgaactc       900
     tgggctccat gggctgaagt gggcgtggca acggcaggaa cagccaccga gcaacttgta       960
     ggtcttggca ttcccgctct gtcacttcct gggaaagggc ctcagttcac ccaaggattc      1020
     gcaaaacgcc aaagtcgatt gctcggcgga gcagtgcgtc catgtcaatc gagccatgag      1080
     ctcaacacac gcctgaatca gcttctcgag gatccgtctc tgagattgca aatgggtcga      1140
     aaaggtcgcc aacgcatggg gcctgccggt ggtagtgaag ccatcgctaa gcgcgttctg      1200
     atccaactgc cgctcggcca cggatactga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page