(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE465

CP000435.PE465       Location/Qualifiers
FT   CDS_pept        complement(472098..472613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45310"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW8"
FT                   /protein_id="ABI45310.1"
FT                   /translation="MDCSPSLRLSPLILILLSSMLIFQMKGSADPNLKVGRYETDTKKC
FT                   SFIDSTQKIAACITLQLKGRSPSVVAVRLIGHGTTKNSRRQLTFVTFTTQGESPLKCST
FT                   GTCRLDAGSWQSKVSSVAEASFNPNGIATGLPKAWAAKNGECSLKNRVLRCSALHFNGE
FT                   IYKAEAYL"
     atggattgct ctccctctct gcgattaagc cccttgatct tgatcctgct gagcagcatg        60
     ctgatctttc agatgaaagg gtctgccgat ccaaatctca aggttggccg ctacgaaacc       120
     gatacaaaaa agtgttcctt catcgacagc acacaaaaga tcgctgcttg catcaccttg       180
     cagctgaagg gacggagtcc atccgtagta gccgtgcgtt taattggtca tggcaccacc       240
     aaaaattccc gtaggcagct cacgttcgtg accttcacaa cacaaggaga atcgcctttg       300
     aaatgcagca caggaacctg tcgcttagat gccgggtcct ggcaaagcaa ggtctcaagc       360
     gtggcagagg catccttcaa ccccaatgga attgcaacgg gcttacccaa agcttgggcc       420
     gccaaaaacg gagaatgcag cttgaaaaac cgagttctac gctgcagcgc tttgcacttc       480
     aatggtgaga tttacaaagc ggaggcgtat ctttag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page