(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE47

CP000435.PE47        Location/Qualifiers
FT   CDS_pept        50173..50553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0048"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46411"
FT                   /db_xref="UniProtKB/TrEMBL:Q0IE36"
FT                   /protein_id="ABI46411.1"
FT                   /translation="MEIRVTLKQGGSVLPMPVEEVVERFLKTKRARIREEWEGKDAAGR
FT                   RSITKERYALIEGKLRNYLVPFLGAKTDARNVPFSKWNEWEGWRVESRHTRTGGKPKAI
FT                   TIQNEMGGKRFLLSGVLMRNPD"
     atggaaatca gggtcactct caaacaggga ggaagtgttc tgccgatgcc tgttgaggag        60
     gtggtggaaa ggtttctcaa aaccaaacgt gcccgtatcc gtgaggaatg ggagggcaag       120
     gatgccgcag ggagaagaag catcaccaag gagaggtatg ccctgattga ggggaagtta       180
     cggaactatc tggtgccgtt tcttggtgcc aagaccgatg cccgcaacgt tccgttttcc       240
     aagtggaacg aatgggaggg atggagggtg gaaagcaggc acacccgcac tggtggcaaa       300
     ccaaaggcaa tcaccatcca aaacgaaatg ggtggcaaaa ggttcctgct gtctggggtg       360
     ctgatgcgga accctgatta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page