(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE472

CP000435.PE472       Location/Qualifiers
FT   CDS_pept        complement(478014..478502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0484"
FT                   /product="low molecular weight phosphotyrosine protein
FT                   phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF01451"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABI45763"
FT                   /db_xref="GOA:Q0ICW1"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICW1"
FT                   /protein_id="ABI45763.1"
FT                   /translation="MTTKVLFVCLGNICRSPAAEGVFLHLIEQRQLMDQFLVDSAGTGG
FT                   WHVGNPADRRMQAAATQRGIHLPSRARQLERGDFDSFDHILAMDQDNLHNVSSMAKEFG
FT                   QRSTVNIRLMLSHARRADTLEVPDPYYGGEQGFEHVLDLLEDACAGLLEDLLAPATKR"
     atgacaacaa aggtgctgtt tgtctgtctc ggaaatatct gccgttcacc agccgctgaa        60
     ggtgtgtttc ttcacctcat cgagcagcga cagctcatgg accagttcct ggttgattcc       120
     gctggtacag ggggctggca tgtagggaat ccagccgatc ggcgcatgca agcagccgcc       180
     acacaacgcg ggattcatct gcctagtcgc gcgcgccaac tcgaacgcgg cgacttcgac       240
     agttttgatc acatcctcgc catggaccaa gacaatctgc acaacgtaag cagcatggcc       300
     aaagaattcg gccagcgaag cacagtcaac attcgcttga tgctgagcca tgcacgtcgg       360
     gcagacactc ttgaggttcc agatccctat tacggaggtg agcaaggctt cgagcatgtg       420
     ctcgatcttc tcgaggatgc ttgcgcagga cttcttgaag acctcttggc tccagccact       480
     aagcgctaa                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page