(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE475

CP000435.PE475       Location/Qualifiers
FT   CDS_pept        complement(479924..480514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0487"
FT                   /product="Protein of unknown function (DUF1001) superfamily
FT                   protein"
FT                   /note="identified by match to protein family HMM PF06206"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46022"
FT                   /db_xref="GOA:Q0ICV8"
FT                   /db_xref="InterPro:IPR010404"
FT                   /db_xref="InterPro:IPR038672"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV8"
FT                   /protein_id="ABI46022.1"
FT                   /translation="MTATIGNFLKNLCGEYSNQKQAFDNPPLFAHIFLRYKPIEHLQPG
FT                   SILLEQTYAVDPKHPYRLRVIRAEEVTSGIIKLWNHTFKAPENFSSATFDDEQRKTIKE
FT                   EDLILLDHCHYQVRQLDNGFFGELEPGCRCIVHRNGKETYLVSSFHLEGDELTTLDRGH
FT                   DPQTHERCWGSIAGEFHFQRISNWAENIPEKWL"
     atgacagcaa cgattggaaa ttttcttaag aatctttgtg gtgaatacag taaccagaaa        60
     caggcatttg acaaccctcc attattcgca catatttttt tacgctataa gccaattgag       120
     catctgcagc caggttcaat ccttctcgag caaacctatg cagtcgatcc taagcatccc       180
     tacagactta gggtaattcg tgcagaagaa gttacttcgg gaatcatcaa actttggaat       240
     catacgttta aagcgccaga aaacttctca agtgccacat ttgatgatga gcaacgaaaa       300
     accattaaag aggaagacct aattcttcta gatcattgcc attatcaagt acgtcaatta       360
     gacaatggat tttttggcga acttgagcct ggatgccgct gcattgtgca tcgcaatggg       420
     aaagagacct atttagtaag cagctttcac cttgagggcg atgaacttac cacattggat       480
     cgtggacatg accctcaaac acacgaacga tgctggggat ctattgctgg tgaattccac       540
     tttcagcgca tcagcaactg ggctgaaaac attcctgaaa agtggttatg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page