(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE479

CP000435.PE479       Location/Qualifiers
FT   CDS_pept        complement(482611..483357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0491"
FT                   /product="15,16-dihydrobiliverdin:ferredoxin
FT                   oxidoreductase"
FT                   /EC_number="1.3.7.2"
FT                   /note="identified by match to protein family HMM PF05996"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46433"
FT                   /db_xref="GOA:Q0ICV4"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="InterPro:IPR023658"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV4"
FT                   /protein_id="ABI46433.1"
FT                   /translation="MLRLILCKDIYTMFDSFLNELHSDITKRGGSALPLPEGLEECRSL
FT                   KTSSVIKSWLWDVPGFRRWRVTRLDAGDSLQVFNSVAYPDYNYDHPLMGVDLLWFGARQ
FT                   KLVAVLDFQPLIQDKDYLDRYFYGLKDLNQRFPDLNSEETMRSFDPNQYFSSWLLFCRG
FT                   GAEQADVSLPNAFSAFLKAYWELHDNAKSIASTIPPEEVKNLQEKYDIYSAERDPAHGL
FT                   FTSHFGKDWSNRFLHEFLFPASSPNK"
     ttgctcagac taatcctttg taaggacatt tacacaatgt ttgattcatt cctcaatgag        60
     cttcattcag atatcaccaa gagaggagga tcggcccttc ctcttccgga aggtctagaa       120
     gaatgcagat ctttaaaaac atcaagtgtc atcaagagct ggctttggga tgttccagga       180
     tttcggcgct ggagggtaac gcgtctcgat gcaggcgata gtctccaagt tttcaattct       240
     gttgcatatc ccgattacaa ctacgatcac cccttaatgg gagttgacct cctctggttc       300
     ggagcccgtc agaagctagt tgccgtactc gatttccagc ccttgatcca agataaagac       360
     tatcttgatc gatattttta tggcctcaag gatctgaatc aacgcttccc ggatctaaac       420
     agtgaggaaa cgatgcgttc gtttgatcca aatcagtatt tttcttcatg gctacttttc       480
     tgtcgtggtg gtgcagaaca agctgatgta tcccttccca atgcttttag tgcattctta       540
     aaagcatact gggaattaca tgataacgcc aaaagtattg cctcaactat tcctccagaa       600
     gaagtcaaaa atctccagga aaaatatgat atttacagcg ccgagaggga tccagctcac       660
     ggactcttta caagccattt tgggaaagac tggtcaaatc ggttcctaca cgaattttta       720
     ttccccgcct cctcccctaa caaatga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page