(data stored in SCRATCH3701 zone)

EMBL: CP000435.PE481

CP000435.PE481       Location/Qualifiers
FT   CDS_pept        complement(483934..484206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="sync_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:sync_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABI46113"
FT                   /db_xref="UniProtKB/TrEMBL:Q0ICV2"
FT                   /protein_id="ABI46113.1"
FT                   /translation="MVTRSVCCKSQVDMTEQTSQAPSLEELIETITELTAYRERLYDDV
FT                   VGLGKKLRLSQKKIDATIKEHPELTRIDAILTQLKVQRDTQESQT"
     atggttacaa ggagtgtttg ctgcaaatca caggtcgaca tgacggaaca aacaagtcag        60
     gcaccttcac ttgaagagct gatcgaaaca attacagaat taactgctta tagggaacga       120
     ctttacgatg atgttgtggg ccttggcaaa aagcttcgtt tatcccaaaa gaaaatcgat       180
     gccacaatca aagagcaccc tgaactcact cggattgatg caattctcac ccaactaaaa       240
     gttcaacgag atacgcaaga gagtcaaaca tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page